Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
20-105047-00-UP-JUMP START ESPRESSO TECHNICAL INFORMATION REPORT-09-02-2021-V3
TABLE OF CONTENTS PAGE 1.0 PROJECT OVERVIEW 1 2.0 CONDITIONS AND REQUIREMENTS SUMMARY 1 3.0 OFF-SITE ANALYSIS 4 4.0 FLOW CONTROL AND WATER QUALITY FACILITY ANALYSIS AND DESIGN 4 5.0 CONVEYANCE SYSTEM ANALYSIS AND DESIGN 6 6.0 SPECIAL REPORTS AND STUDIES 6 7.0 OTHER PERMITS 6 8.0 ESC ANALYSIS AND DESIGN 6 9.0 BOND QUANTITIES, FACILITY SUMMARIES, AND DECLARATION OF COVENANT 7 10.0 OPERATIONS AND MAINTENANCE MANUAL 7 TABLE OF APPENDICES APPENDIX SOIL INFORMATION A MAPS & EXHIBITS B TIR WORKSHEET & STORMWATER ANALYSIS C OFFSITE ANALYSIS D OTHER SPECIAL REPORTS E OPERATION AND MAINTENANCE MANUAL F BOND QUANTITIES WORKSHEET G SOURCE CONTROL MEASURES H JUMP START ESPRESSO TECHNICAL INFORMATION REPORT 1.0 PROJECT OVERVIEW This project will be located on parcel number 1321039067 at 3450 SW 320th Street. This project will be constructed on approximately 0.44 acres and is located in the Dumas Bay drainage basin. The project will comply with the 2016 King County Surface Water Design Manual (KCSWDM) and the Federal Way Addendum. The pre-developed site consists of one parcel and contains no building on site. An existing public conveyance system is located in SW 320th Street. Stormwater runoff from the existing site currently discharges into this system and will continue to discharge here after construction of this project is complete. The completed project will consist of a new 571 square-foot commercial building, a stormwater pond on the west side of the property, driveway, and parking areas. Additionally, the project will require sewer and water service connections to serve the new building. Runoff from the project will be conveyed to the new stormwater detention pond and then will be discharged into the existing conveyance system to the southwest of the project site. No significant impacts are anticipated to the downstream system because developed flows will be restricted to match historic durations and peak flows. No significant impacts are anticipated to the Jump Start Espresso property from any runoff from adjacent properties. 2.0 CONDITIONS AND REQUIREMENTS SUMMARY The existing cover on the site consists of lawn. Slopes vary across the site and are fairly shallow but appear to indicate any stormwater surface flow would travel primarily to the south. Existing stormwater runoff from this site leaves the property by sheet flowing across the existing vegetation and is eventually collected in stormwater conveyance systems along 320th Street. On-site soils are identified in the King County Soil Survey as Everett very gravelly sandy loam (hydrologic soil group A). The geotechnical memo prepared by Geotech Consultants, Inc., dated November 14, 2016, identifies the soils as gravelly silty sand. The project will require full drainage review because it will result in more than 2,000 square feet of new impervious surface and does not qualify for Simplified Site Drainage Review. Core Requirements 1 through 9 and Special Requirements 1 through 5 have been addressed in this report, as follows: Core Requirement #1: Discharge at the Natural Location Under existing conditions stormwater runoff sheet flows across the property lines to the south and enters the public conveyance system. Under developed conditions stormwater from the site will continue to be released into the public conveyance system after exiting the on-site detention facility. Core Requirement #2: Off-site Analysis A downstream analysis was included in Section 3 of this report. Core Requirement #3: Flow Control Facilities This project is in the Conservation Flow Control area and Level 2 Flow Control is required. Developed discharge durations will match predeveloped discharge rates from 50% of the 2-year peak flow up to the full 50-year peak flow in accordance with minimum required performance standards for Level 2 Conservation flow control. The developed peak discharge rates will also match predeveloped peak discharge rates for the 2- and 10-year return periods. Core Requirement #4: Conveyance System All new conveyance pipes will be analyzed to show the following: 1. The conveyance system has sufficient capacity to convey and contain (at minimum) the 25-year peak flow, assuming developed conditions for on-site tributary areas and existing conditions for any off-site tributary areas. 2. The 100-year peak flow to the existing system will not create or aggravate a “severe flooding problem” or “severe erosion problem” as defined in Core Requirement #2 and that any overflow occurring on-site for runoff events up to and including the 100-year event discharges at the natural location for the project site. Core Requirement #5: Erosion and Sediment Control Erosion and sedimentation control has been designed per Appendix D of the 2016 KCSWDM. Core Requirement #6: Maintenance and Operations An operation and maintenance manual is included in Appendix F. Core Requirement #7: Financial Guarantees and Liability A bond quantities worksheet is included in Appendix G. Core Requirement #8: Water Quality This project requires Enhanced Basic Water Quality Treatment per 2016 KCSWDM. Enhanced basic water quality treatment will be provided in a combined detention pond and stormwater wetland per the Enhanced Basic Menu Option 2, Section 6.1.2 of the 2016 King County SWDM. Core Requirement #9: Flow Control BMPs This project will implement flow control BMPs in accordance with Section 1.2.9.2.1 which applies to projects that have an area of less than 22,000 square feet. Special Requirement #1: Other Adopted Area-Specific Requirements None known. Special Requirement #2: Flood Hazard Area Delineation This requirement will not apply to this project because there are no known floodplains or floodways on the property Special Requirement #3: Flood Protection Facilities This requirement will not apply to this project the project does not contain nor is adjacent to a stream that has an existing flood protection facility and also does not propose to construct a new or to modify an existing flood protection facility. Special Requirement #4: Source Controls Water quality source controls that are applicable to this project from the King County Stormwater Pollution Control Manual have been included in Appendix H. Special Requirement #5: Oil Controls This requirement will not apply to this project proposed use does not qualify the finished development as a high-use site. 3.0 OFF-SITE ANALYSIS Downstream Basin of Threshold Discharge Area: A Level 1 downstream analysis was completed for this project in September of 2020. The downstream analysis map is attached in Appendix D. The overall natural slope of the property is towards the south corner of the property and, from there, runoff is collected in the public conveyance system and flows south in a 12” diameter pipe, then continues to the southwest along SW 320th Street in a 30” diameter pipe, then north until it reaches Joes Creek, and continues north until it reaches a quarter of a mile downstream from the project site. No complaints are known to exist from within the last ten years that affect the properties adjacent to the downstream path of the runoff from the project site. From a review of the information available relating to the downstream system, there did not appear to be any existing significant erosion or flooding problems and no significant problems are anticipated to the improvements proposed as part of this project. Upstream Tributary Basin: There are no known concentrated sources of stormwater discharge to this property. 4.0 FLOW CONTROL AND WATER QUALITY FACILITY ANALYSIS AND DESIGN Threshold Discharge Areas and Applicable Requirements for Treatment, Flow Control, and Wetlands Protection There is one threshold discharge area for this project, which encompasses 0.472 acres. The development will include one commercial building, drive aisles, and paved parking with a total impervious area of 0.193 acres and 0.223 acres of landscaping. Predeveloped Site Hydrology As mentioned previously, on-site soils are identified in the King County Soil Survey as Everett very gravelly sandy loam (hydrologic soil group A). The geotechnical memo prepared by Geotech Consultants, Inc., dated November 14, 2016, identifies the soils as gravelly silty sand. Cover characteristics for the existing and historic conditions are as summarized in the table below. PREDEVELOPED CONDITIONS SUB-BASIN FOREST LAWN IMPERVIOUS Project Site 0.472 acres 0.00 acres 0.00 acres Developed Site Hydrology Site cover characteristics for the proposed improvements to this basin are summarized in the table below. DEVELOPED CONDITIONS SUB-BASIN FOREST LAWN IMPERVIOUS POND Project Site 0.000 acres 0.219 acres 0.197 acres 0.056 acres Detailed calculations are included in Appendix C. Performance Standards and Goals This project will provide flow control per Minimum Requirement #7. The detention pond has been designed to match the 2 and 10-year historic peak flow rates and durations for the range of historic flow rates from 50% of the 2-year to the 50-year 5 peak flow rate for on-site improvements. It is not feasible to collect the remaining runoff from the off-site improvements because that area is lower than the site and draining away from the site to the public conveyance system. This bypass is allowed under Section 1.2.3.2.E of the KCSWDM. In addition, this bypass meets the flow control exemption criteria under number five in Section 1.2.3.2.E because there is less than a 0.15 cfs increase in the 100-year peak discharge for the right-of-way bypass area, and because flow control BMP’s are not feasible in the right-of-way. Therefore, this area is not required to be compensated for in the detention pond. The project will provide runoff treatment in compliance with Minimum Requirement #6 since there will be more than 5,000 square feet of effective pollution-generating impervious surface. A stormwater wetland is proposed to provide water quality treatment for the runoff collected from the proposed parking lot and road to meet the enhanced basic water quality requirements for this project. FLOW CONTROL SYSTEM Copies of the detailed calculations are included in Appendix C. Table 1 below provides a summary of the detention analysis results. Table 1: Runoff Summary Return Predeveloped Runoff Rate (CFS) Bypass Release Rate (CFS) Pond Release Rate (CFS) Total Developed Release Rate (CFS) Water Surface Elevations (FT) (pond depth) 2-year 0.014 0.006 0.005 0.010 198.26 (2.95 ft) 10-year 0.026 0.015 0.013 0.022 198.79 (3.48 ft) 50-year 0.034 0.027 0.026 0.037 199.17 (3.86 ft) The detention facility is designed to provide a 50-year volume of 6,550 cubic feet at a depth of 3.86 feet. WATER QUALITY SYSTEM On-site stormwater runoff from the proposed project (0.472 acres) will be treated in a stormwater wetland located in the stormwater detention pond and will meet the Enhanced Basic Water Quality requirements from Section 6.1.2 of the 2016 KCSWDM. The system has been sized to treat the 91% of the runoff volume as calculated using the current version of WWHM. The required water quality volume, as determined by the current version of WWHM, is 0.0353-acre feet (1,538 cubic feet). Section 6.4.3.2 of the 2016 KCSWDM specifies the first cell of the stormwater wetland must have a volume approximately one-third of the water quality volume (513 cubic feet). The proposed stormwater wetland will have a first cell with 1,243 cubic feet and the second cell with 1,061 cubic feet. FLOW CONTROL BMPS Section 1.2.9.2 of the KCSWDM requires that a project that must comply with Core Requirement #9 and which is on a lot that has a size smaller than 22,000 square feet must meet the requirements of Section 1.2.9.2.1 of the KCSWDM (Small Lot). Mitigation of New and Replaced Impervious Surface: Full Dispersion: It is infeasible and, therefore, not required for this project to implement the Full Dispersion BMP. Appendix C, Section C.2.1 of the 2016 KCSWDM states that full dispersion BMPs requires a native vegetated flow path segment of at least 100 feet in length and the property does not have any vegetation on the property that would qualify as native vegetation. Full dispersion BMPs are, therefore, not required to be implemented for this project. Full Infiltration: It is infeasible to apply full infiltration BMPs as detailed in Appendix C, Section C.2.2, because coarse sands, cobbles, or medium sands are required and the existing soils on the property were identified by the geotechnical engineer as gravelly silty sand with near surface glacial till soils. Full infiltration BMPs are, therefore, not required to be implemented for this project. Limited Infiltration: It is infeasible to apply limited infiltration BMPs as detailed in Appendix C, Section C.2.3, because fine or loamy sands, sandy loams, or loams are required and the existing soils on the property were identified by the geotechnical engineer as gravelly silty sand with near surface glacial till soils. Limited infiltration BMPs are, therefore, not required to be implemented for this project. Permeable Pavement: It is infeasible to apply permeable pavement BMPs as detailed in Appendix C, Section C.2.7, because the geotechnical engineer did not determine that infiltration was feasible for this property. Permeable pavement BMPs are, therefore, not required to be implemented for this project. Bioretention: It is infeasible to apply bioretention BMPs as detailed in Appendix C, Section C.2.6, because the geotechnical engineer identified on-site soils as near surface glacial till soils. Bioretention BMP’s are, therefore, not required to be implemented for this project. Basic Dispersion: It is feasible to apply basic dispersion BMPs as detailed in Appendix C, Section C.2.4. Three areas will have vegetated sheet flow dispersion with flow paths. Two of the paths are 10 feet and one is 23.5 feet in length to meet requirements in Section C2.4.5. In total, they will mitigate 4,495 square feet of impervious surface. This project will mitigate 21.87% of the project’s target impervious surfaces. Per Section 1.2.9.2.1 of the KCSWDM, a project on a lot that has between 11,000 and 22,000 square feet of area is required to mitigate an impervious area equal to 20% of the lot area. This project, therefore, will satisfy this requirement 5.0 CONVEYANCE SYSTEM ANALYSIS AND DESIGN The proposed storm system has been sized appropriately with 12-inch pipes with a minimum slope of 0.33% and analyzed with the Manning’s Equation for the expected site runoff during the 100-year peak flow event. The WWHM analysis indicates that the entire site will have a 100-year peak flow rate of 0.233 cfs and a 12-inch pipe with a minimum slope of 0.33% has a flow capacity of 3.36 cfs and, therefore, is more than adequately sized to handle the flow rates that are anticipated. 6.0 SPECIAL REPORTS AND STUDIES A geotechnical report is included in Appendix E of this report. 7.0 OTHER PERMITS Building permits will be required for the new building and utility service permits will be required for the water service connections and sewer service connection from the Lakehaven Water and Sewer District. 8.0 ESC ANALYSIS AND DESIGN Erosion and sediment control requirements will include the delineation of clearing limits via flagging, proper cover measures for the protection of disturbed areas, perimeter protection with silt fencing, and a stabilized construction entrance per City of Federal Way standards. The Erosion and Sediment Control Plan are included as part of the construction plans. 9.0 BOND QUANTITIES, FACILITY SUMMARIES, AND DECLARATION OF COVENANT The bond quantity worksheet is included in Appendix G. 10.0 OPERATIONS AND MAINTENANCE MANUAL Operations and Maintenance Manual is included in Appendix F. APPENDIX A: SOIL INFORMATION APPENDIX B: MAPS & EXHIBITS APPENDIX C: STORMWATER ANALYSIS WWHM2012 PROJECT REPORT Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 2 General Model Information Project Name: Twin Lakes coffee.2021 Site Name: Site Address: City: Report Date: 8/3/2021 Gage: Seatac Data Start: 1948/10/01 Data End: 2009/09/30 Timestep: 15 Minute Precip Scale: 0.000 (adjusted) Version Date: 2019/09/13 Version: 4.2.17 POC Thresholds Low Flow Threshold for POC1: 50 Percent of the 2 Year High Flow Threshold for POC1: 50 Year Low Flow Threshold for POC2: 50 Percent of the 2 Year High Flow Threshold for POC2: 50 Year Low Flow Threshold for POC3: 50 Percent of the 2 Year High Flow Threshold for POC3: 50 Year Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass: No GroundWater: No Pervious Land Use acre C, Forest, Flat 0.472 Pervious Total 0.472 Impervious Land Use acre Impervious Total 0 Basin Total 0.472 Element Flows To: Surface Interflow Groundwater Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 4 Basin 2 Bypass: No GroundWater: No Pervious Land Use acre C, Forest, Flat 0.472 Pervious Total 0.472 Impervious Land Use acre Impervious Total 0 Basin Total 0.472 Element Flows To: Surface Interflow Groundwater Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 5 ROW Bypass Bypass: No GroundWater: No Pervious Land Use acre C, Forest, Flat 0.03 Pervious Total 0.03 Impervious Land Use acre Impervious Total 0 Basin Total 0.03 Element Flows To: Surface Interflow Groundwater Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 6 Mitigated Land Use Basin 1 Bypass: No GroundWater: No Pervious Land Use acre C, Lawn, Flat 0.14 Pervious Total 0.14 Impervious Land Use acre ROADS FLAT 0.152 ROOF TOPS FLAT 0.045 POND 0.056 Impervious Total 0.253 Basin Total 0.393 Element Flows To: Surface Interflow Groundwater Trapezoidal Pond 1 Trapezoidal Pond 1 Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 7 Bypass Bypass: Yes GroundWater: No Pervious Land Use acre C, Lawn, Flat 0.079 Pervious Total 0.079 Impervious Land Use acre Impervious Total 0 Basin Total 0.079 Element Flows To: Surface Interflow Groundwater Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 8 ROW Bypass Bypass: No GroundWater: No Pervious Land Use acre Pervious Total 0 Impervious Land Use acre ROADS FLAT 0.03 Impervious Total 0.03 Basin Total 0.03 Element Flows To: Surface Interflow Groundwater Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 9 Routing Elements Predeveloped Routing Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 10 Mitigated Routing Trapezoidal Pond 1 Bottom Length: 70.00 ft. Bottom Width: 20.80 ft. Depth: 5.1 ft. Volume at riser head: 0.1526 acre-feet. Side slope 1: 0 To 1 Side slope 2: 3 To 1 Side slope 3: 0 To 1 Side slope 4: 3 To 1 Discharge Structure Riser Height: 3.9 ft. Riser Diameter: 12 in. Orifice 1 Diameter: 0.3125 in.Elevation:0 ft. Orifice 2 Diameter: 0.625 in. Elevation:3 ft. Orifice 3 Diameter: 0.8125 in.Elevation:3.5 ft. Element Flows To: Outlet 1 Outlet 2 Pond Hydraulic Table Stage(feet) Area(ac.) Volume(ac-ft.) Discharge(cfs) Infilt(cfs) 0.0000 0.033 0.000 0.000 0.000 0.0567 0.033 0.001 0.000 0.000 0.1133 0.033 0.003 0.000 0.000 0.1700 0.033 0.005 0.001 0.000 0.2267 0.034 0.007 0.001 0.000 0.2833 0.034 0.009 0.001 0.000 0.3400 0.034 0.011 0.001 0.000 0.3967 0.034 0.013 0.001 0.000 0.4533 0.034 0.015 0.001 0.000 0.5100 0.034 0.017 0.001 0.000 0.5667 0.035 0.019 0.002 0.000 0.6233 0.035 0.021 0.002 0.000 0.6800 0.035 0.023 0.002 0.000 0.7367 0.035 0.025 0.002 0.000 0.7933 0.035 0.027 0.002 0.000 0.8500 0.035 0.029 0.002 0.000 0.9067 0.036 0.031 0.002 0.000 0.9633 0.036 0.033 0.002 0.000 1.0200 0.036 0.035 0.002 0.000 1.0767 0.036 0.037 0.002 0.000 1.1333 0.036 0.039 0.002 0.000 1.1900 0.036 0.041 0.002 0.000 1.2467 0.037 0.043 0.003 0.000 1.3033 0.037 0.046 0.003 0.000 1.3600 0.037 0.048 0.003 0.000 1.4167 0.037 0.050 0.003 0.000 1.4733 0.037 0.052 0.003 0.000 1.5300 0.037 0.054 0.003 0.000 1.5867 0.038 0.056 0.003 0.000 1.6433 0.038 0.058 0.003 0.000 1.7000 0.038 0.061 0.003 0.000 1.7567 0.038 0.063 0.003 0.000 1.8133 0.038 0.065 0.003 0.000 Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 11 1.8700 0.038 0.067 0.003 0.000 1.9267 0.038 0.069 0.003 0.000 1.9833 0.039 0.071 0.003 0.000 2.0400 0.039 0.074 0.003 0.000 2.0967 0.039 0.076 0.003 0.000 2.1533 0.039 0.078 0.003 0.000 2.2100 0.039 0.080 0.003 0.000 2.2667 0.039 0.083 0.004 0.000 2.3233 0.040 0.085 0.004 0.000 2.3800 0.040 0.087 0.004 0.000 2.4367 0.040 0.090 0.004 0.000 2.4933 0.040 0.092 0.004 0.000 2.5500 0.040 0.094 0.004 0.000 2.6067 0.040 0.096 0.004 0.000 2.6633 0.041 0.099 0.004 0.000 2.7200 0.041 0.101 0.004 0.000 2.7767 0.041 0.103 0.004 0.000 2.8333 0.041 0.106 0.004 0.000 2.8900 0.041 0.108 0.004 0.000 2.9467 0.041 0.110 0.004 0.000 3.0033 0.042 0.113 0.005 0.000 3.0600 0.042 0.115 0.007 0.000 3.1167 0.042 0.118 0.008 0.000 3.1733 0.042 0.120 0.009 0.000 3.2300 0.042 0.122 0.009 0.000 3.2867 0.042 0.125 0.010 0.000 3.3433 0.043 0.127 0.011 0.000 3.4000 0.043 0.130 0.011 0.000 3.4567 0.043 0.132 0.012 0.000 3.5133 0.043 0.135 0.014 0.000 3.5700 0.043 0.137 0.017 0.000 3.6267 0.043 0.140 0.019 0.000 3.6833 0.044 0.142 0.021 0.000 3.7400 0.044 0.145 0.023 0.000 3.7967 0.044 0.147 0.024 0.000 3.8533 0.044 0.150 0.025 0.000 3.9100 0.044 0.152 0.037 0.000 3.9667 0.044 0.155 0.210 0.000 4.0233 0.045 0.157 0.483 0.000 4.0800 0.045 0.160 0.814 0.000 4.1367 0.045 0.162 1.166 0.000 4.1933 0.045 0.165 1.504 0.000 4.2500 0.045 0.167 1.794 0.000 4.3067 0.045 0.170 2.015 0.000 4.3633 0.045 0.173 2.165 0.000 4.4200 0.046 0.175 2.306 0.000 4.4767 0.046 0.178 2.428 0.000 4.5333 0.046 0.181 2.543 0.000 4.5900 0.046 0.183 2.654 0.000 4.6467 0.046 0.186 2.760 0.000 4.7033 0.046 0.188 2.862 0.000 4.7600 0.047 0.191 2.960 0.000 4.8167 0.047 0.194 3.056 0.000 4.8733 0.047 0.196 3.148 0.000 4.9300 0.047 0.199 3.238 0.000 4.9867 0.047 0.202 3.326 0.000 5.0433 0.047 0.205 3.411 0.000 5.1000 0.048 0.207 3.494 0.000 Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 12 5.1567 0.048 0.210 3.575 0.000 Twin Lakes coffee.2021 8/3/2021 8:33:40 AM Page 13 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area: 0.472 Total Impervious Area: 0 Mitigated Landuse Totals for POC #1 Total Pervious Area: 0.219 Total Impervious Area: 0.253 Flow Frequency Method: Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.013877 5 year 0.021795 10 year 0.026282 25 year 0.031035 50 year 0.033977 100 year 0.036479 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.010455 5 year 0.016963 10 year 0.022198 25 year 0.029939 50 year 0.036573 100 year 0.043992 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.014 0.016 1950 0.017 0.018 1951 0.031 0.030 1952 0.010 0.005 1953 0.008 0.010 1954 0.012 0.008 1955 0.019 0.008 1956 0.015 0.016 1957 0.012 0.010 1958 0.014 0.007 Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 14 1959 0.012 0.007 1960 0.021 0.014 1961 0.012 0.010 1962 0.007 0.005 1963 0.010 0.009 1964 0.013 0.009 1965 0.009 0.011 1966 0.009 0.007 1967 0.019 0.018 1968 0.012 0.010 1969 0.012 0.010 1970 0.009 0.007 1971 0.010 0.012 1972 0.023 0.026 1973 0.010 0.011 1974 0.011 0.010 1975 0.015 0.011 1976 0.011 0.008 1977 0.001 0.006 1978 0.010 0.007 1979 0.006 0.005 1980 0.022 0.023 1981 0.009 0.007 1982 0.017 0.018 1983 0.015 0.009 1984 0.009 0.006 1985 0.005 0.007 1986 0.024 0.010 1987 0.021 0.012 1988 0.008 0.006 1989 0.005 0.005 1990 0.044 0.034 1991 0.027 0.023 1992 0.010 0.008 1993 0.011 0.006 1994 0.004 0.005 1995 0.015 0.009 1996 0.033 0.028 1997 0.027 0.027 1998 0.006 0.009 1999 0.025 0.026 2000 0.011 0.009 2001 0.002 0.004 2002 0.012 0.015 2003 0.015 0.012 2004 0.019 0.018 2005 0.014 0.009 2006 0.016 0.014 2007 0.033 0.036 2008 0.043 0.022 2009 0.021 0.013 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0445 0.0365 2 0.0426 0.0338 3 0.0330 0.0303 Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 15 4 0.0325 0.0278 5 0.0306 0.0272 6 0.0272 0.0261 7 0.0268 0.0260 8 0.0255 0.0230 9 0.0241 0.0226 10 0.0228 0.0218 11 0.0216 0.0184 12 0.0213 0.0184 13 0.0209 0.0181 14 0.0207 0.0178 15 0.0194 0.0157 16 0.0191 0.0157 17 0.0189 0.0153 18 0.0170 0.0137 19 0.0166 0.0136 20 0.0164 0.0134 21 0.0154 0.0121 22 0.0152 0.0118 23 0.0152 0.0116 24 0.0150 0.0114 25 0.0149 0.0113 26 0.0139 0.0105 27 0.0138 0.0105 28 0.0136 0.0104 29 0.0131 0.0102 30 0.0122 0.0100 31 0.0120 0.0099 32 0.0118 0.0099 33 0.0118 0.0098 34 0.0118 0.0093 35 0.0117 0.0092 36 0.0115 0.0090 37 0.0112 0.0090 38 0.0110 0.0088 39 0.0108 0.0085 40 0.0107 0.0085 41 0.0103 0.0085 42 0.0103 0.0078 43 0.0102 0.0076 44 0.0100 0.0075 45 0.0096 0.0074 46 0.0096 0.0073 47 0.0095 0.0072 48 0.0094 0.0069 49 0.0092 0.0069 50 0.0090 0.0068 51 0.0086 0.0066 52 0.0084 0.0060 53 0.0078 0.0057 54 0.0073 0.0056 55 0.0061 0.0056 56 0.0058 0.0055 57 0.0055 0.0049 58 0.0054 0.0048 59 0.0036 0.0046 60 0.0019 0.0045 61 0.0013 0.0038 Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 16 Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 17 Duration Flows The Facility PASSED Flow(cfs) Predev Mit Percentage Pass/Fail 0.0069 17554 9394 53 Pass 0.0072 16164 8515 52 Pass 0.0075 14966 7779 51 Pass 0.0078 13851 7187 51 Pass 0.0080 12814 6787 52 Pass 0.0083 11807 6393 54 Pass 0.0086 10898 5967 54 Pass 0.0089 10119 5642 55 Pass 0.0091 9383 5354 57 Pass 0.0094 8729 5063 58 Pass 0.0097 8145 4791 58 Pass 0.0099 7593 4528 59 Pass 0.0102 7073 4286 60 Pass 0.0105 6596 4028 61 Pass 0.0108 6149 3797 61 Pass 0.0110 5781 3510 60 Pass 0.0113 5437 3268 60 Pass 0.0116 5099 3050 59 Pass 0.0119 4810 2808 58 Pass 0.0121 4530 2663 58 Pass 0.0124 4252 2513 59 Pass 0.0127 4019 2374 59 Pass 0.0129 3790 2216 58 Pass 0.0132 3546 2050 57 Pass 0.0135 3339 1854 55 Pass 0.0138 3138 1674 53 Pass 0.0140 2954 1552 52 Pass 0.0143 2787 1437 51 Pass 0.0146 2599 1329 51 Pass 0.0149 2449 1221 49 Pass 0.0151 2304 1120 48 Pass 0.0154 2162 1012 46 Pass 0.0157 2029 905 44 Pass 0.0160 1898 826 43 Pass 0.0162 1790 776 43 Pass 0.0165 1690 735 43 Pass 0.0168 1584 693 43 Pass 0.0170 1483 651 43 Pass 0.0173 1382 625 45 Pass 0.0176 1292 607 46 Pass 0.0179 1220 582 47 Pass 0.0181 1155 564 48 Pass 0.0184 1098 550 50 Pass 0.0187 1048 532 50 Pass 0.0190 997 519 52 Pass 0.0192 930 507 54 Pass 0.0195 883 484 54 Pass 0.0198 838 468 55 Pass 0.0200 789 453 57 Pass 0.0203 743 430 57 Pass 0.0206 713 416 58 Pass 0.0209 670 396 59 Pass 0.0211 630 380 60 Pass Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 18 0.0214 596 368 61 Pass 0.0217 567 348 61 Pass 0.0220 539 324 60 Pass 0.0222 497 308 61 Pass 0.0225 473 283 59 Pass 0.0228 436 271 62 Pass 0.0231 399 258 64 Pass 0.0233 367 248 67 Pass 0.0236 348 230 66 Pass 0.0239 323 220 68 Pass 0.0241 296 207 69 Pass 0.0244 273 196 71 Pass 0.0247 256 184 71 Pass 0.0250 235 171 72 Pass 0.0252 217 162 74 Pass 0.0255 195 153 78 Pass 0.0258 180 138 76 Pass 0.0261 158 127 80 Pass 0.0263 145 117 80 Pass 0.0266 129 107 82 Pass 0.0269 119 96 80 Pass 0.0271 109 81 74 Pass 0.0274 97 71 73 Pass 0.0277 91 54 59 Pass 0.0280 82 41 50 Pass 0.0282 76 31 40 Pass 0.0285 69 23 33 Pass 0.0288 61 21 34 Pass 0.0291 54 19 35 Pass 0.0293 48 16 33 Pass 0.0296 41 14 34 Pass 0.0299 38 9 23 Pass 0.0302 33 4 12 Pass 0.0304 27 2 7 Pass 0.0307 22 2 9 Pass 0.0310 21 2 9 Pass 0.0312 20 2 10 Pass 0.0315 19 2 10 Pass 0.0318 17 2 11 Pass 0.0321 14 2 14 Pass 0.0323 12 2 16 Pass 0.0326 8 2 25 Pass 0.0329 4 2 50 Pass 0.0332 3 2 66 Pass 0.0334 3 2 66 Pass 0.0337 3 2 66 Pass 0.0340 3 1 33 Pass Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 19 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume: 0 acre-feet On-line facility target flow: 0 cfs. Adjusted for 15 min: 0 cfs. Off-line facility target flow: 0 cfs. Adjusted for 15 min: 0 cfs. Twin Lakes coffee.2021 8/3/2021 8:34:23 AM Page 20 LID Report Twin Lakes coffee.2021 8/3/2021 8:35:44 AM Page 21 POC 2 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #2 Total Pervious Area: 0.472 Total Impervious Area: 0 Mitigated Landuse Totals for POC #2 Total Pervious Area: 0.14 Total Impervious Area: 0.253 Flow Frequency Method: Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #2 Return Period Flow(cfs) 2 year 0.013877 5 year 0.021795 10 year 0.026282 25 year 0.031035 50 year 0.033977 100 year 0.036479 Flow Frequency Return Periods for Mitigated. POC #2 Return Period Flow(cfs) 2 year 0.1055 5 year 0.136948 10 year 0.158769 25 year 0.187544 50 year 0.209889 100 year 0.233039 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #2 Year Predeveloped Mitigated 1949 0.014 0.145 1950 0.017 0.138 1951 0.031 0.090 1952 0.010 0.071 1953 0.008 0.077 1954 0.012 0.086 1955 0.019 0.095 1956 0.015 0.094 1957 0.012 0.113 1958 0.014 0.085 1959 0.012 0.082 Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 22 1960 0.021 0.094 1961 0.012 0.095 1962 0.007 0.077 1963 0.010 0.092 1964 0.013 0.085 1965 0.009 0.117 1966 0.009 0.073 1967 0.019 0.131 1968 0.012 0.146 1969 0.012 0.107 1970 0.009 0.099 1971 0.010 0.118 1972 0.023 0.133 1973 0.010 0.067 1974 0.011 0.110 1975 0.015 0.114 1976 0.011 0.085 1977 0.001 0.082 1978 0.010 0.104 1979 0.006 0.140 1980 0.022 0.151 1981 0.009 0.109 1982 0.017 0.160 1983 0.015 0.121 1984 0.009 0.080 1985 0.005 0.109 1986 0.024 0.092 1987 0.021 0.139 1988 0.008 0.082 1989 0.005 0.102 1990 0.044 0.225 1991 0.027 0.170 1992 0.010 0.079 1993 0.011 0.066 1994 0.004 0.068 1995 0.015 0.096 1996 0.033 0.112 1997 0.027 0.106 1998 0.006 0.098 1999 0.025 0.219 2000 0.011 0.106 2001 0.002 0.107 2002 0.012 0.143 2003 0.015 0.111 2004 0.019 0.203 2005 0.014 0.093 2006 0.016 0.084 2007 0.033 0.201 2008 0.043 0.167 2009 0.021 0.125 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #2 Rank Predeveloped Mitigated 1 0.0445 0.2245 2 0.0426 0.2194 3 0.0330 0.2032 4 0.0325 0.2008 Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 23 5 0.0306 0.1702 6 0.0272 0.1671 7 0.0268 0.1601 8 0.0255 0.1513 9 0.0241 0.1461 10 0.0228 0.1452 11 0.0216 0.1433 12 0.0213 0.1399 13 0.0209 0.1390 14 0.0207 0.1382 15 0.0194 0.1330 16 0.0191 0.1306 17 0.0189 0.1251 18 0.0170 0.1207 19 0.0166 0.1177 20 0.0164 0.1175 21 0.0154 0.1138 22 0.0152 0.1127 23 0.0152 0.1120 24 0.0150 0.1114 25 0.0149 0.1103 26 0.0139 0.1093 27 0.0138 0.1089 28 0.0136 0.1074 29 0.0131 0.1067 30 0.0122 0.1060 31 0.0120 0.1056 32 0.0118 0.1037 33 0.0118 0.1021 34 0.0118 0.0986 35 0.0117 0.0982 36 0.0115 0.0957 37 0.0112 0.0953 38 0.0110 0.0946 39 0.0108 0.0944 40 0.0107 0.0938 41 0.0103 0.0934 42 0.0103 0.0916 43 0.0102 0.0916 44 0.0100 0.0903 45 0.0096 0.0860 46 0.0096 0.0853 47 0.0095 0.0852 48 0.0094 0.0851 49 0.0092 0.0844 50 0.0090 0.0823 51 0.0086 0.0818 52 0.0084 0.0816 53 0.0078 0.0796 54 0.0073 0.0788 55 0.0061 0.0769 56 0.0058 0.0767 57 0.0055 0.0733 58 0.0054 0.0710 59 0.0036 0.0681 60 0.0019 0.0671 61 0.0013 0.0656 Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 24 Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 25 Duration Flows Flow(cfs) Predev Mit Percentage Pass/Fail 0.0069 17554 96143 547 Fail 0.0072 16164 92827 574 Fail 0.0075 14966 89662 599 Fail 0.0078 13851 86475 624 Fail 0.0080 12814 83523 651 Fail 0.0083 11807 80764 684 Fail 0.0086 10898 78048 716 Fail 0.0089 10119 75524 746 Fail 0.0091 9383 73128 779 Fail 0.0094 8729 70840 811 Fail 0.0097 8145 68551 841 Fail 0.0099 7593 66434 874 Fail 0.0102 7073 64402 910 Fail 0.0105 6596 62413 946 Fail 0.0108 6149 60509 984 Fail 0.0110 5781 58691 1015 Fail 0.0113 5437 56916 1046 Fail 0.0116 5099 55140 1081 Fail 0.0119 4810 53515 1112 Fail 0.0121 4530 51932 1146 Fail 0.0124 4252 50371 1184 Fail 0.0127 4019 48873 1216 Fail 0.0129 3790 47419 1251 Fail 0.0132 3546 45986 1296 Fail 0.0135 3339 44703 1338 Fail 0.0138 3138 43462 1385 Fail 0.0140 2954 42200 1428 Fail 0.0143 2787 40895 1467 Fail 0.0146 2599 39740 1529 Fail 0.0149 2449 38564 1574 Fail 0.0151 2304 37452 1625 Fail 0.0154 2162 36361 1681 Fail 0.0157 2029 35377 1743 Fail 0.0160 1898 34372 1810 Fail 0.0162 1790 33409 1866 Fail 0.0165 1690 32468 1921 Fail 0.0168 1584 31570 1993 Fail 0.0170 1483 30693 2069 Fail 0.0173 1382 29859 2160 Fail 0.0176 1292 29046 2248 Fail 0.0179 1220 28255 2315 Fail 0.0181 1155 27506 2381 Fail 0.0184 1098 26800 2440 Fail 0.0187 1048 26052 2485 Fail 0.0190 997 25303 2537 Fail 0.0192 930 24640 2649 Fail 0.0195 883 23977 2715 Fail 0.0198 838 23314 2782 Fail 0.0200 789 22694 2876 Fail 0.0203 743 22052 2967 Fail 0.0206 713 21496 3014 Fail 0.0209 670 20955 3127 Fail 0.0211 630 20375 3234 Fail 0.0214 596 19877 3335 Fail Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 26 0.0217 567 19340 3410 Fail 0.0220 539 18831 3493 Fail 0.0222 497 18362 3694 Fail 0.0225 473 17911 3786 Fail 0.0228 436 17458 4004 Fail 0.0231 399 17036 4269 Fail 0.0233 367 16583 4518 Fail 0.0236 348 16172 4647 Fail 0.0239 323 15746 4874 Fail 0.0241 296 15327 5178 Fail 0.0244 273 14938 5471 Fail 0.0247 256 14574 5692 Fail 0.0250 235 14271 6072 Fail 0.0252 217 13922 6415 Fail 0.0255 195 13610 6979 Fail 0.0258 180 13282 7378 Fail 0.0261 158 12979 8214 Fail 0.0263 145 12660 8731 Fail 0.0266 129 12335 9562 Fail 0.0269 119 12059 10133 Fail 0.0271 109 11751 10780 Fail 0.0274 97 11460 11814 Fail 0.0277 91 11206 12314 Fail 0.0280 82 10908 13302 Fail 0.0282 76 10647 14009 Fail 0.0285 69 10391 15059 Fail 0.0288 61 10166 16665 Fail 0.0291 54 9929 18387 Fail 0.0293 48 9734 20279 Fail 0.0296 41 9509 23192 Fail 0.0299 38 9285 24434 Fail 0.0302 33 9109 27603 Fail 0.0304 27 8896 32948 Fail 0.0307 22 8703 39559 Fail 0.0310 21 8472 40342 Fail 0.0312 20 8301 41505 Fail 0.0315 19 8115 42710 Fail 0.0318 17 7931 46652 Fail 0.0321 14 7747 55335 Fail 0.0323 12 7578 63150 Fail 0.0326 8 7405 92562 Fail 0.0329 4 7225 180625 Fail 0.0332 3 7069 235633 Fail 0.0334 3 6900 230000 Fail 0.0337 3 6765 225500 Fail 0.0340 3 6607 220233 Fail The development has an increase in flow durations from 1/2 Predeveloped 2 year flow to the 2 year flow or more than a 10% increase from the 2 year to the 50 year flow. The development has an increase in flow durations for more than 50% of the flows for the range of the duration analysis. Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 27 Water Quality Water Quality BMP Flow and Volume for POC #2 On-line facility volume: 0.0353 acre-feet On-line facility target flow: 0.0404 cfs. Adjusted for 15 min: 0.0404 cfs. Off-line facility target flow: 0.0226 cfs. Adjusted for 15 min: 0.0226 cfs. Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 28 LID Report Twin Lakes coffee.2021 8/3/2021 8:36:13 AM Page 29 POC 3 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #3 Total Pervious Area: 0.03 Total Impervious Area: 0 Mitigated Landuse Totals for POC #3 Total Pervious Area: 0 Total Impervious Area: 0.03 Flow Frequency Method: Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #3 Return Period Flow(cfs) 2 year 0.000882 5 year 0.001385 10 year 0.00167 25 year 0.001973 50 year 0.00216 100 year 0.002319 Flow Frequency Return Periods for Mitigated. POC #3 Return Period Flow(cfs) 2 year 0.011438 5 year 0.014447 10 year 0.016492 25 year 0.019145 50 year 0.021175 100 year 0.023254 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #3 Year Predeveloped Mitigated 1949 0.001 0.015 1950 0.001 0.016 1951 0.002 0.009 1952 0.001 0.008 1953 0.000 0.009 1954 0.001 0.009 1955 0.001 0.011 1956 0.001 0.010 1957 0.001 0.012 1958 0.001 0.009 1959 0.001 0.010 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 30 1960 0.001 0.010 1961 0.001 0.010 1962 0.000 0.009 1963 0.001 0.010 1964 0.001 0.010 1965 0.001 0.012 1966 0.001 0.008 1967 0.001 0.014 1968 0.001 0.016 1969 0.001 0.011 1970 0.001 0.011 1971 0.001 0.013 1972 0.001 0.013 1973 0.001 0.008 1974 0.001 0.012 1975 0.001 0.013 1976 0.001 0.009 1977 0.000 0.010 1978 0.001 0.012 1979 0.000 0.016 1980 0.001 0.015 1981 0.001 0.012 1982 0.001 0.017 1983 0.001 0.014 1984 0.001 0.009 1985 0.000 0.012 1986 0.002 0.010 1987 0.001 0.016 1988 0.001 0.010 1989 0.000 0.012 1990 0.003 0.020 1991 0.002 0.016 1992 0.001 0.009 1993 0.001 0.007 1994 0.000 0.008 1995 0.001 0.011 1996 0.002 0.011 1997 0.002 0.011 1998 0.000 0.011 1999 0.002 0.023 2000 0.001 0.011 2001 0.000 0.012 2002 0.001 0.014 2003 0.001 0.011 2004 0.001 0.021 2005 0.001 0.010 2006 0.001 0.009 2007 0.002 0.020 2008 0.003 0.016 2009 0.001 0.015 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #3 Rank Predeveloped Mitigated 1 0.0028 0.0227 2 0.0027 0.0213 3 0.0021 0.0204 4 0.0021 0.0199 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 31 5 0.0019 0.0169 6 0.0017 0.0163 7 0.0017 0.0163 8 0.0016 0.0160 9 0.0015 0.0160 10 0.0014 0.0159 11 0.0014 0.0159 12 0.0014 0.0148 13 0.0013 0.0148 14 0.0013 0.0146 15 0.0012 0.0145 16 0.0012 0.0140 17 0.0012 0.0137 18 0.0011 0.0134 19 0.0011 0.0131 20 0.0010 0.0127 21 0.0010 0.0124 22 0.0010 0.0121 23 0.0010 0.0121 24 0.0010 0.0120 25 0.0009 0.0119 26 0.0009 0.0119 27 0.0009 0.0118 28 0.0009 0.0116 29 0.0008 0.0113 30 0.0008 0.0113 31 0.0008 0.0113 32 0.0008 0.0111 33 0.0007 0.0110 34 0.0007 0.0110 35 0.0007 0.0107 36 0.0007 0.0106 37 0.0007 0.0105 38 0.0007 0.0104 39 0.0007 0.0103 40 0.0007 0.0101 41 0.0007 0.0097 42 0.0007 0.0097 43 0.0006 0.0097 44 0.0006 0.0097 45 0.0006 0.0097 46 0.0006 0.0095 47 0.0006 0.0095 48 0.0006 0.0095 49 0.0006 0.0093 50 0.0006 0.0093 51 0.0005 0.0090 52 0.0005 0.0089 53 0.0005 0.0088 54 0.0005 0.0087 55 0.0004 0.0086 56 0.0004 0.0086 57 0.0003 0.0082 58 0.0003 0.0081 59 0.0002 0.0081 60 0.0001 0.0079 61 0.0001 0.0074 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 32 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 33 Duration Flows Flow(cfs) Predev Mit Percentage Pass/Fail 0.0004 17547 131669 750 Fail 0.0005 16191 128739 795 Fail 0.0005 15006 125916 839 Fail 0.0005 13854 122943 887 Fail 0.0005 12831 120248 937 Fail 0.0005 11860 117724 992 Fail 0.0005 10902 115179 1056 Fail 0.0006 10138 112826 1112 Fail 0.0006 9415 110516 1173 Fail 0.0006 8737 108142 1237 Fail 0.0006 8166 106024 1298 Fail 0.0006 7591 103800 1367 Fail 0.0006 7071 101875 1440 Fail 0.0007 6598 99993 1515 Fail 0.0007 6145 97939 1593 Fail 0.0007 5784 96164 1662 Fail 0.0007 5448 94389 1732 Fail 0.0007 5099 92592 1815 Fail 0.0008 4815 90860 1887 Fail 0.0008 4539 89191 1964 Fail 0.0008 4254 87437 2055 Fail 0.0008 4021 85769 2133 Fail 0.0008 3779 84122 2226 Fail 0.0008 3551 82668 2328 Fail 0.0009 3343 81170 2428 Fail 0.0009 3136 79631 2539 Fail 0.0009 2954 78219 2647 Fail 0.0009 2791 76807 2751 Fail 0.0009 2599 75331 2898 Fail 0.0009 2449 74027 3022 Fail 0.0010 2312 72679 3143 Fail 0.0010 2162 71374 3301 Fail 0.0010 2028 70155 3459 Fail 0.0010 1895 68851 3633 Fail 0.0010 1790 67674 3780 Fail 0.0010 1693 66519 3929 Fail 0.0011 1583 65300 4125 Fail 0.0011 1483 64166 4326 Fail 0.0011 1383 63076 4560 Fail 0.0011 1292 61921 4792 Fail 0.0011 1221 60851 4983 Fail 0.0012 1156 59867 5178 Fail 0.0012 1098 58819 5356 Fail 0.0012 1049 57857 5515 Fail 0.0012 996 56873 5710 Fail 0.0012 930 55889 6009 Fail 0.0012 884 54926 6213 Fail 0.0013 836 53921 6449 Fail 0.0013 789 53066 6725 Fail 0.0013 743 52146 7018 Fail 0.0013 713 51290 7193 Fail 0.0013 669 50456 7542 Fail 0.0013 633 49643 7842 Fail 0.0014 595 48809 8203 Fail Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 34 0.0014 567 48082 8480 Fail 0.0014 538 47248 8782 Fail 0.0014 496 46499 9374 Fail 0.0014 473 45708 9663 Fail 0.0014 434 44981 10364 Fail 0.0015 399 44211 11080 Fail 0.0015 369 43505 11789 Fail 0.0015 348 42756 12286 Fail 0.0015 323 42093 13031 Fail 0.0015 296 41430 13996 Fail 0.0016 272 40788 14995 Fail 0.0016 256 40125 15673 Fail 0.0016 235 39484 16801 Fail 0.0016 217 38885 17919 Fail 0.0016 197 38243 19412 Fail 0.0016 180 37559 20866 Fail 0.0017 158 36981 23405 Fail 0.0017 145 36382 25091 Fail 0.0017 129 35741 27706 Fail 0.0017 119 35206 29584 Fail 0.0017 109 34671 31808 Fail 0.0017 97 34137 35192 Fail 0.0018 91 33602 36925 Fail 0.0018 82 33046 40300 Fail 0.0018 76 32532 42805 Fail 0.0018 69 32019 46404 Fail 0.0018 61 31506 51649 Fail 0.0018 54 31057 57512 Fail 0.0019 48 30565 63677 Fail 0.0019 41 30094 73400 Fail 0.0019 38 29645 78013 Fail 0.0019 33 29196 88472 Fail 0.0019 27 28682 106229 Fail 0.0020 22 28297 128622 Fail 0.0020 21 27870 132714 Fail 0.0020 20 27399 136995 Fail 0.0020 19 27014 142178 Fail 0.0020 17 26565 156264 Fail 0.0020 13 26180 201384 Fail 0.0021 12 25795 214958 Fail 0.0021 8 25367 317087 Fail 0.0021 4 25004 625100 Fail 0.0021 3 24640 821333 Fail 0.0021 3 24234 807800 Fail 0.0021 3 23913 797100 Fail 0.0022 3 23485 782833 Fail The development has an increase in flow durations from 1/2 Predeveloped 2 year flow to the 2 year flow or more than a 10% increase from the 2 year to the 50 year flow. The development has an increase in flow durations for more than 50% of the flows for the range of the duration analysis. Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 35 Water Quality Water Quality BMP Flow and Volume for POC #3 On-line facility volume: 0 acre-feet On-line facility target flow: 0 cfs. Adjusted for 15 min: 0 cfs. Off-line facility target flow: 0 cfs. Adjusted for 15 min: 0 cfs. Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 36 LID Report Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 37 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 38 Appendix Predeveloped Schematic Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 39 Mitigated Schematic Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 40 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 Twin Lakes coffee.2021.wdm MESSU 25 PreTwin Lakes coffee.2021.MES 27 PreTwin Lakes coffee.2021.L61 28 PreTwin Lakes coffee.2021.L62 30 POCTwin Lakes coffee.20211.dat 31 POCTwin Lakes coffee.20212.dat 32 POCTwin Lakes coffee.20213.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 COPY 502 COPY 503 DISPLY 1 DISPLY 2 DISPLY 3 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 2 Basin 2 MAX 1 2 31 9 3 ROW Bypass MAX 1 2 32 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 502 1 1 503 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 41 # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 42 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 10 0.472 COPY 501 12 PERLND 10 0.472 COPY 501 13 Basin 2*** PERLND 10 0.472 COPY 502 12 PERLND 10 0.472 COPY 502 13 ROW Bypass*** PERLND 10 0.03 COPY 503 12 PERLND 10 0.03 COPY 503 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 COPY 502 OUTPUT MEAN 1 1 48.4 DISPLY 2 INPUT TIMSER 1 COPY 503 OUTPUT MEAN 1 1 48.4 DISPLY 3 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 43 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL COPY 502 OUTPUT MEAN 1 1 48.4 WDM 502 FLOW ENGL REPL COPY 503 OUTPUT MEAN 1 1 48.4 WDM 503 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 44 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 Twin Lakes coffee.2021.wdm MESSU 25 MitTwin Lakes coffee.2021.MES 27 MitTwin Lakes coffee.2021.L61 28 MitTwin Lakes coffee.2021.L62 31 POCTwin Lakes coffee.20212.dat 32 POCTwin Lakes coffee.20213.dat 30 POCTwin Lakes coffee.20211.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 1 IMPLND 4 IMPLND 14 RCHRES 1 COPY 502 COPY 503 COPY 1 COPY 501 COPY 601 DISPLY 2 DISPLY 3 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 2 Basin 1 MAX 1 2 31 9 3 ROW Bypass MAX 1 2 32 9 1 Trapezoidal Pond 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 502 1 1 503 1 1 501 1 1 601 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 45 in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 1 ROADS/FLAT 1 1 1 27 0 4 ROOF TOPS/FLAT 1 1 1 27 0 14 POND 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 1 0 0 1 0 0 0 4 0 0 1 0 0 0 14 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 46 # - # ATMP SNOW IWAT SLD IWG IQAL ********* 1 0 0 4 0 0 0 1 9 4 0 0 4 0 0 0 1 9 14 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 1 0 0 0 0 0 4 0 0 0 0 0 14 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 1 400 0.01 0.1 0.1 4 400 0.01 0.1 0.1 14 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN 1 0 0 4 0 0 14 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 1 0 0 4 0 0 14 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 16 0.14 RCHRES 1 2 PERLND 16 0.14 RCHRES 1 3 IMPLND 1 0.152 RCHRES 1 5 IMPLND 4 0.045 RCHRES 1 5 IMPLND 14 0.056 RCHRES 1 5 Basin 1*** PERLND 16 0.14 COPY 502 12 PERLND 16 0.14 COPY 502 13 IMPLND 1 0.152 COPY 502 15 IMPLND 4 0.045 COPY 502 15 IMPLND 14 0.056 COPY 502 15 Bypass*** PERLND 16 0.079 COPY 501 12 PERLND 16 0.079 COPY 601 12 PERLND 16 0.079 COPY 501 13 PERLND 16 0.079 COPY 601 13 ROW Bypass*** IMPLND 1 0.03 COPY 503 15 ******Routing****** PERLND 16 0.14 COPY 1 12 IMPLND 1 0.152 COPY 1 15 IMPLND 4 0.045 COPY 1 15 IMPLND 14 0.056 COPY 1 15 PERLND 16 0.14 COPY 1 13 RCHRES 1 1 COPY 501 16 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 47 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 502 OUTPUT MEAN 1 1 48.4 DISPLY 2 INPUT TIMSER 1 COPY 503 OUTPUT MEAN 1 1 48.4 DISPLY 3 INPUT TIMSER 1 COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Trapezoidal Pond-005 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** 1 1 0.01 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 91 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.033425 0.000000 0.000000 0.056667 0.033588 0.001899 0.000631 0.113333 0.033750 0.003807 0.000892 0.170000 0.033912 0.005724 0.001093 0.226667 0.034075 0.007650 0.001262 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 48 0.283333 0.034237 0.009585 0.001411 0.340000 0.034399 0.011530 0.001545 0.396667 0.034562 0.013484 0.001669 0.453333 0.034724 0.015447 0.001784 0.510000 0.034886 0.017419 0.001893 0.566667 0.035049 0.019401 0.001995 0.623333 0.035211 0.021392 0.002092 0.680000 0.035373 0.023392 0.002185 0.736667 0.035536 0.025401 0.002275 0.793333 0.035698 0.027419 0.002360 0.850000 0.035860 0.029446 0.002443 0.906667 0.036023 0.031483 0.002523 0.963333 0.036185 0.033529 0.002601 1.020000 0.036347 0.035584 0.002676 1.076667 0.036510 0.037648 0.002750 1.133333 0.036672 0.039722 0.002821 1.190000 0.036835 0.041805 0.002891 1.246667 0.036997 0.043896 0.002959 1.303333 0.037159 0.045997 0.003025 1.360000 0.037322 0.048108 0.003090 1.416667 0.037484 0.050227 0.003154 1.473333 0.037646 0.052356 0.003217 1.530000 0.037809 0.054494 0.003278 1.586667 0.037971 0.056641 0.003338 1.643333 0.038133 0.058797 0.003397 1.700000 0.038296 0.060963 0.003455 1.756667 0.038458 0.063137 0.003512 1.813333 0.038620 0.065321 0.003569 1.870000 0.038783 0.067514 0.003624 1.926667 0.038945 0.069717 0.003678 1.983333 0.039107 0.071928 0.003732 2.040000 0.039270 0.074149 0.003785 2.096667 0.039432 0.076379 0.003837 2.153333 0.039594 0.078618 0.003889 2.210000 0.039757 0.080866 0.003940 2.266667 0.039919 0.083124 0.003990 2.323333 0.040082 0.085390 0.004039 2.380000 0.040244 0.087666 0.004088 2.436667 0.040406 0.089951 0.004137 2.493333 0.040569 0.092246 0.004185 2.550000 0.040731 0.094549 0.004232 2.606667 0.040893 0.096862 0.004279 2.663333 0.041056 0.099184 0.004325 2.720000 0.041218 0.101515 0.004371 2.776667 0.041380 0.103855 0.004416 2.833333 0.041543 0.106204 0.004461 2.890000 0.041705 0.108563 0.004505 2.946667 0.041867 0.110931 0.004549 3.003333 0.042030 0.113308 0.005205 3.060000 0.042192 0.115694 0.007232 3.116667 0.042354 0.118090 0.008299 3.173333 0.042517 0.120495 0.009134 3.230000 0.042679 0.122908 0.009847 3.286667 0.042842 0.125332 0.010480 3.343333 0.043004 0.127764 0.011057 3.400000 0.043166 0.130205 0.011591 3.456667 0.043329 0.132656 0.012090 3.513333 0.043491 0.135116 0.014631 3.570000 0.043653 0.137585 0.017750 3.626667 0.043816 0.140063 0.019814 3.683333 0.043978 0.142551 0.021519 3.740000 0.044140 0.145047 0.023020 3.796667 0.044303 0.147553 0.024383 3.853333 0.044465 0.150068 0.025643 3.910000 0.044627 0.152593 0.037439 3.966667 0.044790 0.155126 0.210172 4.023333 0.044952 0.157669 0.483646 4.080000 0.045114 0.160221 0.814293 4.136667 0.045277 0.162782 1.166641 4.193333 0.045439 0.165352 1.504514 Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 49 4.250000 0.045601 0.167932 1.794905 4.306667 0.045764 0.170520 2.015720 4.363333 0.045926 0.173118 2.165833 4.420000 0.046089 0.175725 2.306617 4.476667 0.046251 0.178342 2.427977 4.533333 0.046413 0.180967 2.543525 4.590000 0.046576 0.183602 2.654027 4.646667 0.046738 0.186246 2.760090 4.703333 0.046900 0.188899 2.862211 4.760000 0.047063 0.191561 2.960800 4.816667 0.047225 0.194232 3.056201 4.873333 0.047387 0.196913 3.148704 4.930000 0.047550 0.199603 3.238559 4.986667 0.047712 0.202302 3.325980 5.043333 0.047874 0.205010 3.411157 5.100000 0.048037 0.207728 3.494253 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 2 OUTPUT MEAN 1 1 48.4 WDM 702 FLOW ENGL REPL COPY 502 OUTPUT MEAN 1 1 48.4 WDM 802 FLOW ENGL REPL COPY 602 OUTPUT MEAN 1 1 48.4 WDM 902 FLOW ENGL REPL RCHRES 1 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1001 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL COPY 601 OUTPUT MEAN 1 1 48.4 WDM 901 FLOW ENGL REPL COPY 3 OUTPUT MEAN 1 1 48.4 WDM 703 FLOW ENGL REPL COPY 503 OUTPUT MEAN 1 1 48.4 WDM 803 FLOW ENGL REPL COPY 603 OUTPUT MEAN 1 1 48.4 WDM 903 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 50 END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN Twin Lakes coffee.2021 8/3/2021 8:36:43 AM Page 51 Predeveloped HSPF Message File Twin Lakes coffee.2021 8/3/2021 8:36:44 AM Page 52 Mitigated HSPF Message File ERROR/WARNING ID: 238 1 The continuity error reported below is greater than 1 part in 1000 and is therefore considered high. Did you specify any "special actions"? If so, they could account for it. Relevant data are: DATE/TIME: 1999/ 9/30 24: 0 RCHRES : 1 RELERR STORS STOR MATIN MATDIF -4.823E-03 0.00000 0.0000E+00 0.00000 -1.477E-08 Where: RELERR is the relative error (ERROR/REFVAL). ERROR is (STOR-STORS) - MATDIF. REFVAL is the reference value (STORS+MATIN). STOR is the storage of material in the processing unit (land-segment or reach/reservior) at the end of the present interval. STORS is the storage of material in the pu at the start of the present printout reporting period. MATIN is the total inflow of material to the pu during the present printout reporting period. MATDIF is the net inflow (inflow-outflow) of material to the pu during the present printout reporting period. ERROR/WARNING ID: 238 1 The continuity error reported below is greater than 1 part in 1000 and is therefore considered high. Did you specify any "special actions"? If so, they could account for it. Relevant data are: DATE/TIME: 2002/ 8/31 24: 0 RCHRES : 1 RELERR STORS STOR MATIN MATDIF -2.821E-02 0.00000 0.0000E+00 0.00000 -2.428E-09 Where: RELERR is the relative error (ERROR/REFVAL). ERROR is (STOR-STORS) - MATDIF. REFVAL is the reference value (STORS+MATIN). STOR is the storage of material in the processing unit (land-segment or reach/reservior) at the end of the present interval. STORS is the storage of material in the pu at the start of the present printout reporting period. MATIN is the total inflow of material to the pu during the present printout reporting period. MATDIF is the net inflow (inflow-outflow) of material to the pu during the present printout reporting period. ERROR/WARNING ID: 238 1 The continuity error reported below is greater than 1 part in 1000 and is therefore considered high. Did you specify any "special actions"? If so, they could account for it. Relevant data are: Twin Lakes coffee.2021 8/3/2021 8:36:44 AM Page 53 DATE/TIME: 2004/ 7/31 24: 0 RCHRES : 1 RELERR STORS STOR MATIN MATDIF -5.701E-03 0.00000 0.0000E+00 0.00000 -1.231E-08 Where: RELERR is the relative error (ERROR/REFVAL). ERROR is (STOR-STORS) - MATDIF. REFVAL is the reference value (STORS+MATIN). STOR is the storage of material in the processing unit (land-segment or reach/reservior) at the end of the present interval. STORS is the storage of material in the pu at the start of the present printout reporting period. MATIN is the total inflow of material to the pu during the present printout reporting period. MATDIF is the net inflow (inflow-outflow) of material to the pu during the present printout reporting period. ERROR/WARNING ID: 238 1 The continuity error reported below is greater than 1 part in 1000 and is therefore considered high. Did you specify any "special actions"? If so, they could account for it. Relevant data are: DATE/TIME: 2006/ 7/31 24: 0 RCHRES : 1 RELERR STORS STOR MATIN MATDIF -1.496E-02 0.00000 0.0000E+00 0.00000 -4.703E-09 Where: RELERR is the relative error (ERROR/REFVAL). ERROR is (STOR-STORS) - MATDIF. REFVAL is the reference value (STORS+MATIN). STOR is the storage of material in the processing unit (land-segment or reach/reservior) at the end of the present interval. STORS is the storage of material in the pu at the start of the present printout reporting period. MATIN is the total inflow of material to the pu during the present printout reporting period. MATDIF is the net inflow (inflow-outflow) of material to the pu during the present printout reporting period. Twin Lakes coffee.2021 8/3/2021 8:36:44 AM Page 54 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2021; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com APPENDIX D: OFF-SITE ANALYSIS KingKing County iMapDate: 9/28/2020 Notes:The information included on this map has been compiled by King County staff from a variety of sources and is subject to changewithout notice. King County makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness,or rights to the use of such information. This document is not intended for use as a survey product. King County shall not be liablefor any general, special, indirect, incidental, or consequential damages including, but not limited to, lost revenues or lost profitsresulting from the use or misuse of the information contained on this map. Any sale of this map or information on this map isprohibited except by written permission of King County.±JUMP START ESPRESSO DOWNSTREAM MAP1/4MILEDOWNSTREAMPROJECT SITE1321039067PRIMARYOUTFALLEXG PUBLICCONVEYANCESYSTEMSTREAM APPENDIX E: OTHER SPECIAL REPORTS APPENDIX F: OPERATION & MAINTENANCE MANUAL STORMWATER POLLUTION PREVENTION MAINTENANCE and OPERATION SCHEDULE for Jump Start Espresso Site Address: The project is located at 3450 SW 320th Street, Federal Way, WA in Section 13, Township 21 North, Range 3 East, W.M. The development will occur on tax parcel number 1321039067. Introduction: This stormwater site plan has been prepared to address the City of Federal Way’s site development and storm drainage requirements for the proposed Jump Start Espresso project. Approximately 0.44 acres of the site will be disturbed for construction. The subject site will be developed by constructing a new building and access. According to the City of Federal Way’s standards for stormwater management, the city requires stormwater quantity and quality control for all proposed developments where they meet the thresholds in the City’s Surface Water Design Manual. This project will provide flow control by providing a detention pond to match the 2 and 10- year historic peak flow rates and durations for the range of historic flow rates from 50% of the 2-year to the 50-year peak flow rate. Plan Goal: The specific purpose for the stormwater facility is to minimize pollution that is typically associated with modern development. This includes, in general, pollution from motor vehicles and pollution generated from erosion. Attached to this narrative is a maintenance manual, which offers guidelines to the owner for stormwater facility maintenance. Prevention BMP’s: Any catch basins shall have stenciled on them “DUMP NO WASTE – DRAINS TO STREAM.” The owner shall be responsible for sweeping the lot, installing storm drainage stenciling and providing spill control procedures. In case of spill, call the Washington State Department of Ecology at (425) 649-7000. The catch basins must be visually inspected for accumulation of debris and silt and will be maintained as required by this operation and maintenance manual and attachments. Maintenance Standards for Drainage Facilities: No. 1 - Detention Ponds No. 4 - Control Structure/Flow Restrictor No. 5 - Catch Basins and Manholes No. 6 - Conveyance Pipes and Ditches No. 11 - Grounds (Landscaping) No. 31 – Bioretention BMP Treatment BMP’s: The project will install a BioPod for runoff treatment. Inspection/Maintenance: Regular inspections of the stormwater facilities should be carried out twice per year, in the spring and fall. The responsible party should keep records of these inspections available for review by the City. Additional inspections may be required after severe seasonal storms. Routine maintenance of the site will include mowing, care of landscaping, and the removal of trash and debris from the proposed detention facilities. The driveways should be kept clean and in repair. Events such as major storms or heavy winds will require immediate inspections for damages. Be careful to avoid introducing landscape fertilizer to receiving waters or groundwater. Catch basins shall be cleaned when sump contains four inches or more of sediment or debris. Plan and/or Information Updates: The City of Kent Storm Drainage Utility section is to review and approve any changes to this Operation and Maintenance Manual prior to changes in its implementation. Additionally, any changes in ownership or person of responsibility are to be reported to the City Storm Drainage Utility section. Person of Responsibility: Design Engineer: Twin Lakes Plaza LLC AP Consulting Engineers PLLC Mr. Court Pixton Adam E. Paul, PE 33919 9th Avenue South, Suite 105 PO Box 162 Federal Way, WA, 98003 Auburn, WA 98071 INSPECTION/MAINTENANCE CHECKLIST STRUCTURE RESULTS/ MAINTENANCE DATE NOTES All Catch Basins Inspection results Maintenance Done Detention Pond Inspection results Maintenance Done Conveyance System Inspection Results Maintenance Done Control Structure/Flow Restrictor Inspection Results Maintenance Done Grounds (Landscaping) Inspection Results Maintenance Done Bioretention BMP Inspection Results Maintenance Done $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± '(7(17,21321'6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFH,V1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFH,V3HUIRUPHG 6LWH 7UDVKDQGGHEULV $Q\WUDVKDQGGHEULVZKLFKH[FHHGFXELFIRRW SHUVTXDUHIHHWWKLVLVDERXWHTXDOWRWKH DPRXQWRIWUDVKLWZRXOGWDNHWRILOOXSRQH VWDQGDUGVL]HRIILFHJDUEDJHFDQ,QJHQHUDO WKHUHVKRXOGEHQRYLVXDOHYLGHQFHRIGXPSLQJ 7UDVKDQGGHEULVFOHDUHGIURPVLWH 1R[LRXVZHHGV $Q\QR[LRXVRUQXLVDQFHYHJHWDWLRQZKLFKPD\ FRQVWLWXWHDKD]DUGWR&RXQW\SHUVRQQHORUWKH SXEOLF 1R[LRXVDQGQXLVDQFHYHJHWDWLRQ UHPRYHGDFFRUGLQJWRDSSOLFDEOH UHJXODWLRQV1RGDQJHURIQR[LRXV YHJHWDWLRQZKHUH&RXQW\SHUVRQQHO RUWKHSXEOLFPLJKWQRUPDOO\EH &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP *UDVVJURXQGFRYHU *UDVVRUJURXQGFRYHU H[FHHGVLQFKHVLQ KHLJKW *UDVVRUJURXQGFRYHUPRZHGWRD KHLJKWQRJUHDWHUWKDQLQFKHV 7RSRU6LGH6ORSHV RI'DP%HUPRU (PEDQNPHQW 5RGHQWKROHV $Q\HYLGHQFHRIURGHQWKROHVLIIDFLOLW\LVDFWLQJ DVDGDPRUEHUPRUDQ\HYLGHQFHRIZDWHU SLSLQJWKURXJKGDPRUEHUPYLDURGHQWKROHV 5RGHQWVUHPRYHGRUGHVWUR\HGDQG GDPRUEHUPUHSDLUHG 7UHHJURZWK 7UHHJURZWKWKUHDWHQVLQWHJULW\RIVORSHVGRHV QRWDOORZPDLQWHQDQFHDFFHVVRULQWHUIHUHVZLWK PDLQWHQDQFHDFWLYLW\,IWUHHVDUHQRWDWKUHDWRU QRWLQWHUIHULQJZLWKDFFHVVRUPDLQWHQDQFHWKH\ GRQRWQHHGWREHUHPRYHG 7UHHV GRQRWKLQGHU IDFLOLW\ SHUIRUPDQFHRUPDLQWHQDQFH DFWLYLWLHV (URVLRQ (URGHGGDPDJHRYHULQFKHVGHHSZKHUHFDXVH RIGDPDJHLVVWLOOSUHVHQWRUZKHUHWKHUHLV SRWHQWLDOIRUFRQWLQXHGHURVLRQ$Q\HURVLRQ REVHUYHGRQDFRPSDFWHGVORSH 6ORSHVVWDELOL]HGXVLQJDSSURSULDWH HURVLRQFRQWUROPHDVXUHV,IHURVLRQ LVRFFXUULQJRQFRPSDFWHGVORSHD OLFHQVHGFLYLOHQJLQHHUVKRXOGEH FRQVXOWHGWRUHVROYHVRXUFHRI HURVLRQ 6HWWOHPHQW $Q\SDUWRIDGDPEHUPRUHPEDQNPHQWWKDW KDVVHWWOHGLQFKHVORZHUWKDQWKHGHVLJQ HOHYDWLRQ 7RSRUVLGHVORSHUHVWRUHGWRGHVLJQ GLPHQVLRQV,IVHWWOHPHQWLV VLJQLILFDQWDOLFHQVHGFLYLOHQJLQHHU VKRXOGEHFRQVXOWHGWRGHWHUPLQH WKHFDXVH RIWKHVHWWOHPHQW 6WRUDJH$UHD 6HGLPHQW DFFXPXODWLRQ $FFXPXODWHGVHGLPHQWWKDWH[FHHGVRIWKH GHVLJQHGSRQGGHSWK 6HGLPHQWFOHDQHGRXWWRGHVLJQHG SRQGVKDSHDQGGHSWKSRQG UHVHHGHGLIQHFHVVDU\WRFRQWURO HURVLRQ /LQHUGDPDJHG ,I$SSOLFDEOH /LQHULVYLVLEOHRUSRQGGRHVQRWKROGZDWHUDV GHVLJQHG /LQHUUHSDLUHGRUUHSODFHG ,QOHW2XWOHW3LSH 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWILOOLQJRUPRUHRIWKHSLSH ,QOHWRXWOHWSLSHVFOHDURIVHGLPHQW 7UDVKDQGGHEULV 7UDVKDQGGHEULVDFFXPXODWHGLQLQOHWRXWOHW SLSHVLQFOXGHVIORDWDEOHVDQGQRQIORDWDEOHV 1RWUDVKRUGHEULVLQSLSHV 'DPDJHG &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLO HQWHULQJ DWWKHMRLQWV RIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFK ZLGHDW WKHMRLQWRIWKHLQOHWRXWOHWSLSH (PHUJHQF\ 2YHUIORZ6SLOOZD\ 7UHHJURZWK 7UHHJURZWKLPSHGHVIORZRUWKUHDWHQVVWDELOLW\RI VSLOOZD\ 7UHHVUHPRYHG 5RFNPLVVLQJ 2QO\RQHOD\HURIURFNH[LVWVDERYHQDWLYHVRLOLQ DUHDILYHVTXDUHIHHWRUODUJHURUDQ\H[SRVXUHRI QDWLYHVRLORQWKHVSLOOZD\ 6SLOOZD\ UHVWRUHGWRGHVLJQ VWDQGDUGV 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &21752/ 6758&785()/2: 5(675,&725 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 6WUXFWXUH 7UDVKDQGGHEULV 7UDVKRUGHEULVRIPRUHWKDQòFXELFIRRWZKLFK LVORFDWHGLPPHGLDWHO\LQIURQWRIWKHVWUXFWXUH RSHQLQJRULVEORFNLQJFDSDFLW\RIWKHVWUXFWXUH E\PRUHWKDQ 1R7UDVKRUGHEULVEORFNLQJRU SRWHQWLDOO\EORFNLQJHQWUDQFHWR VWUXFWXUH 7UDVKRUGHEULVLQWKHVWUXFWXUHWKDWH[FHHGV WKHGHSWKIURPWKHERWWRPRIEDVLQWRLQYHUWWKH ORZHVWSLSHLQWRRURXWRIWKHEDVLQ 1RWUDVKRUGHEULVLQWKHVWUXFWXUH 'HSRVLWVRIJDUEDJHH[FHHGLQJFXELFIRRWLQ YROXPH 1RFRQGLWLRQSUHVHQWZKLFKZRXOG DWWUDFWRUVXSSRUWWKHEUHHGLQJRI LQVHFWVRUURGHQWV 6HGLPHQW 6HGLPHQWH[FHHGVRIWKHGHSWKIURPWKH ERWWRPRIWKHVWUXFWXUHWRWKHLQYHUWRIWKHORZHVW SLSHLQWRRURXWRIWKHVWUXFWXUHRUWKHERWWRPRI WKH)5237VHFWLRQRULVZLWKLQLQFKHVRIWKH LQYHUWRIWKHORZHVWSLSHLQWRRURXWRIWKH VWUXFWXUHRUWKHERWWRPRIWKH)5237VHFWLRQ 6XPSRIVWUXFWXUHFRQWDLQVQR VHGLPHQW 'DPDJHWRIUDPH DQGRUWRSVODE &RUQHURIIUDPHH[WHQGVPRUHWKDQôLQFKSDVW FXUEIDFHLQWRWKHVWUHHW,IDSSOLFDEOH )UDPHLVHYHQZLWKFXUE 7RSVODEKDVKROHVODUJHUWKDQVTXDUHLQFKHV RUFUDFNVZLGHUWKDQóLQFK 7RSVODELVIUHH RIKROHVDQGFUDFNV )UDPHQRWVLWWLQJIOXVKRQWRSVODELH VHSDUDWLRQRIPRUHWKDQôLQFKRIWKHIUDPHIURP WKHWRSVODE )UDPHLVVLWWLQJIOXVKRQWRSVODE &UDFNVLQZDOOVRU ERWWRP &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIHHW DQ\HYLGHQFH RIVRLOSDUWLFOHVHQWHULQJVWUXFWXUH WKURXJKFUDFNVRUPDLQWHQDQFHSHUVRQMXGJHV WKDWVWUXFWXUHLVXQVRXQG 6WUXFWXUHLVVHDOHGDQGVWUXFWXUDOO\ VRXQG &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIRRW DWWKHMRLQWRIDQ\LQOHWRXWOHWSLSHRUDQ\ HYLGHQFHRIVRLOSDUWLFOHVHQWHULQJVWUXFWXUH WKURXJKFUDFNV 1RFUDFNVPRUHWKDQLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSH 6HWWOHPHQW PLVDOLJQPHQW 6WUXFWXUHKDVVHWWOHGPRUHWKDQLQFKRUKDV URWDWHGPRUHWKDQLQFKHVRXWRIDOLJQPHQW %DVLQUHSODFHGRUUHSDLUHGWRGHVLJQ VWDQGDUGV 'DPDJHGSLSHMRLQWV &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ WKHVWUXFWXUHDWWKHMRLQWRIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSHV &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP /DGGHUUXQJVPLVVLQJ RUXQVDIH /DGGHULVXQVDIHGXHWRPLVVLQJUXQJV PLVDOLJQPHQWUXVWFUDFNVRUVKDUSHGJHV /DGGHUPHHWVGHVLJQVWDQGDUGVDQG DOORZVPDLQWHQDQFHSHUVRQVDIH DFFHVV )52376HFWLRQ 'DPDJH 7VHFWLRQLVQRWVHFXUHO\DWWDFKHGWRVWUXFWXUH ZDOODQGRXWOHWSLSHVWUXFWXUHVKRXOGVXSSRUWDW OHDVWOEVRIXSRUGRZQSUHVVXUH 7VHFWLRQVHFXUHO\DWWDFKHGWRZDOO DQGRXWOHWSLSH 6WUXFWXUH LVQRWLQXSULJKWSRVLWLRQDOORZXSWR IURPSOXPE 6WUXFWXUHLQFRUUHFWSRVLWLRQ &RQQHFWLRQVWRRXWOHWSLSHDUHQRWZDWHUWLJKWRU VKRZVLJQVRIGHWHULRUDWHGJURXW &RQQHFWLRQVWRRXWOHWSLSHDUHZDWHU WLJKWVWUXFWXUHUHSDLUHGRUUHSODFHG DQGZRUNVDVGHVLJQHG $Q\KROHV²RWKHUWKDQGHVLJQHGKROHV²LQWKH VWUXFWXUH 6WUXFWXUHKDVQRKROHVRWKHUWKDQ GHVLJQHGKROHV 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &21752/ 6758&785()/2: 5(675,&725 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG &OHDQRXW*DWH 'DPDJHGRUPLVVLQJ &OHDQRXWJDWHLVPLVVLQJ 5HSODFHFOHDQRXWJDWH &OHDQRXWJDWHLVQRWZDWHUWLJKW *DWHLVZDWHUWLJKWDQGZRUNVDV GHVLJQHG *DWHFDQQRWEHPRYHGXSDQGGRZQE\RQH PDLQWHQDQFHSHUVRQ *DWHPRYHVXSDQGGRZQHDVLO\DQG LVZDWHUWLJKW &KDLQURGOHDGLQJWRJDWHLVPLVVLQJRUGDPDJHG &KDLQLVLQSODFHDQGZRUNVDV GHVLJQHG 2ULILFH3ODWH 'DPDJHGRUPLVVLQJ &RQWUROGHYLFHLVQRWZRUNLQJSURSHUO\GXHWR PLVVLQJRXWRISODFHRUEHQWRULILFHSODWH 3ODWHLVLQSODFHDQGZRUNVDV GHVLJQHG 2EVWUXFWLRQV $Q\WUDVKGHEULVVHGLPHQW RUYHJHWDWLRQ EORFNLQJWKHSODWH 3ODWHLVIUHHRIDOOREVWUXFWLRQVDQG ZRUNVDVGHVLJQHG 2YHUIORZ3LSH 2EVWUXFWLRQV $Q\WUDVKRUGHEULVEORFNLQJRUKDYLQJWKH SRWHQWLDORIEORFNLQJWKHRYHUIORZSLSH 3LSHLVIUHHRI DOOREVWUXFWLRQVDQG ZRUNVDVGHVLJQHG 'HIRUPHGRU GDPDJHGOLS /LSRIRYHUIORZSLSHLVEHQWRUGHIRUPHG 2YHUIORZSLSHGRHVQRWDOORZ RYHUIORZDWDQHOHYDWLRQORZHUWKDQ GHVLJQ ,QOHW2XWOHW3LSH 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWILOOLQJRUPRUHRIWKHSLSH ,QOHWRXWOHWSLSHVFOHDURIVHGLPHQW 7UDVKDQGGHEULV 7UDVKDQGGHEULVDFFXPXODWHGLQLQOHWRXWOHW SLSHVLQFOXGHVIORDWDEOHVDQGQRQIORDWDEOHV 1RWUDVKRUGHEULVLQSLSHV 'DPDJHG &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ DWWKHMRLQWV RIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRIWKHLQOHWRXWOHWSLSH 0HWDO*UDWHV ,I$SSOLFDEOH 8QVDIHJUDWHRSHQLQJ *UDWHZLWKRSHQLQJZLGHUWKDQ LQFK *UDWHRSHQLQJPHHWVGHVLJQ VWDQGDUGV 7UDVKDQGGHEULV 7UDVKDQGGHEULVWKDWLVEORFNLQJPRUHWKDQ RIJUDWHVXUIDFH *UDWHIUHHRIWUDVKDQGGHEULV IRRWQRWHWRJXLGHOLQHVIRUGLVSRVDO 'DPDJHGRUPLVVLQJ *UDWHPLVVLQJRUEURNHQPHPEHUVRIWKHJUDWH *UDWHLVLQSODFHDQGPHHWVGHVLJQ VWDQGDUGV 0DQKROH&RYHU/LG &RYHUOLGQRWLQSODFH &RYHUOLGLVPLVVLQJRURQO\SDUWLDOO\LQSODFH $Q\RSHQVWUXFWXUHUHTXLUHVXUJHQW PDLQWHQDQFH &RYHUOLGSURWHFWVRSHQLQJWR VWUXFWXUH /RFNLQJPHFKDQLVP 1RW:RUNLQJ 0HFKDQLVPFDQQRWEHRSHQHGE\RQH PDLQWHQDQFHSHUVRQZLWKSURSHUWRROV%ROWV FDQQRWEHVHDWHG6HOIORFNLQJFRYHUOLGGRHVQRW ZRUN 0HFKDQLVPRSHQVZLWKSURSHUWRROV &RYHUOLGGLIILFXOWWR 5HPRYH 2QHPDLQWHQDQFHSHUVRQFDQQRWUHPRYH FRYHUOLGDIWHUDSSO\LQJOEVRIOLIW &RYHUOLGFDQEHUHPRYHGDQG UHLQVWDOOHGE\RQHPDLQWHQDQFH SHUVRQ 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &$7&+%$6,16 $1'0$1+2/(6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 6WUXFWXUH 6HGLPHQW 6HGLPHQWH[FHHGVRIWKHGHSWKIURPWKH ERWWRP RIWKHFDWFKEDVLQWRWKHLQYHUWRIWKH ORZHVWSLSHLQWRRURXWRIWKHFDWFKEDVLQRULV ZLWKLQLQFKHVRIWKHLQYHUWRIWKHORZHVWSLSH LQWRRURXWRIWKHFDWFKEDVLQ 6XPSRIFDWFKEDVLQFRQWDLQVQR VHGLPHQW 7UDVKDQGGHEULV 7UDVKRUGHEULVRIPRUHWKDQòFXELFIRRWZKLFK LVORFDWHGLPPHGLDWHO\LQIURQWRIWKHFDWFKEDVLQ RSHQLQJRULVEORFNLQJFDSDFLW\RIWKHFDWFKEDVLQ E\PRUHWKDQ 1R7UDVKRUGHEULVEORFNLQJRU SRWHQWLDOO\EORFNLQJHQWUDQFHWR FDWFKEDVLQ 7UDVKRUGHEULVLQWKHFDWFKEDVLQ WKDWH[FHHGVWKHGHSWKIURPWKHERWWRPRIEDVLQWRLQYHUW WKHORZHVWSLSHLQWRRURXWRIWKHEDVLQ 1RWUDVKRUGHEULVLQWKHFDWFK EDVLQ 'HDGDQLPDOVRUYHJHWDWLRQWKDWFRXOGJHQHUDWH RGRUVWKDWFRXOGFDXVHFRPSODLQWVRUGDQJHURXV JDVHVHJPHWKDQH 1RGHDGDQLPDOVRUYHJHWDWLRQ SUHVHQWZLWKLQFDWFKEDVLQ 'HSRVLWVRIJDUEDJHH[FHHGLQJFXELFIRRWLQ YROXPH 1RFRQGLWLRQSUHVHQWZKLFKZRXOG DWWUDFWRUVXSSRUWWKHEUHHGLQJRI LQVHFWVRUURGHQWV 'DPDJHWRIUDPH DQGRUWRSVODE &RUQHURI IUDPHH[WHQGVPRUHWKDQôLQFKSDVW FXUEIDFHLQWRWKHVWUHHW,IDSSOLFDEOH )UDPHLVHYHQZLWKFXUE 7RSVODEKDVKROHVODUJHUWKDQVTXDUHLQFKHV RUFUDFNVZLGHUWKDQóLQFK 7RSVODELVIUHHRIKROHVDQGFUDFNV )UDPHQRWVLWWLQJIOXVKRQWRSVODELH VHSDUDWLRQRIPRUHWKDQôLQFKRIWKHIUDPHIURP WKHWRSVODE )UDPHLVVLWWLQJIOXVKRQWRSVODE &UDFNVLQZDOOVRU ERWWRP &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIHHW DQ\HYLGHQFHRIVRLOSDUWLFOHVHQWHULQJFDWFK EDVLQWKURXJKFUDFNVRUPDLQWHQDQFHSHUVRQ MXGJHVWKDWFDWFKEDVLQLVXQVRXQG &DWFKEDVLQLVVHDOHGDQGLV VWUXFWXUDOO\VRXQG &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIRRW DWWKHMRLQWRIDQ\LQOHWRXWOHWSLSHRUDQ\ HYLGHQFHRIVRLOSDUWLFOHVHQWHULQJFDWFKEDVLQ WKURXJKFUDFNV 1RFUDFNVPRUHWKDQLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSH 6HWWOHPHQW PLVDOLJQPHQW &DWFKEDVLQKDVVHWWOHGPRUHWKDQLQFKRUKDV URWDWHGPRUHWKDQLQFKHVRXWRIDOLJQPHQW %DVLQUHSODFHGRUUHSDLUHGWRGHVLJQ VWDQGDUGV 'DPDJHGSLSHMRLQWV &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ WKHFDWFKEDVLQDWWKHMRLQWRIWKHLQOHWRXWOHW SLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSHV &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQ D VXUIDFHRLOILOP ,QOHW2XWOHW3LSH 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWILOOLQJRUPRUHRIWKHSLSH ,QOHWRXWOHWSLSHVFOHDURIVHGLPHQW 7UDVKDQGGHEULV 7UDVKDQGGHEULVDFFXPXODWHGLQLQOHWRXWOHW SLSHVLQFOXGHVIORDWDEOHVDQGQRQIORDWDEOHV 1RWUDVKRUGHEULVLQSLSHV 'DPDJHG &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ DWWKHMRLQWV RIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRIWKHLQOHWRXWOHWSLSH 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &$7&+%$6,16 $1'0$1+2/(6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 0HWDO*UDWHV &DWFK%DVLQV 8QVDIHJUDWHRSHQLQJ *UDWHZLWKRSHQLQJZLGHUWKDQ LQFK *UDWHRSHQLQJPHHWVGHVLJQ VWDQGDUGV 7UDVKDQGGHEULV 7UDVKDQGGHEULVWKDWLVEORFNLQJPRUHWKDQ RIJUDWHVXUIDFH *UDWHIUHHRIWUDVKDQGGHEULV IRRWQRWHWRJXLGHOLQHVIRUGLVSRVDO 'DPDJHGRUPLVVLQJ *UDWHPLVVLQJRUEURNHQPHPEHUVRIWKHJUDWH $Q\RSHQVWUXFWXUHUHTXLUHVXUJHQW PDLQWHQDQFH *UDWHLVLQSODFHDQGPHHWVGHVLJQ VWDQGDUGV 0DQKROH&RYHU/LG &RYHUOLGQRWLQSODFH &RYHUOLGLVPLVVLQJRURQO\SDUWLDOO\LQSODFH $Q\RSHQVWUXFWXUHUHTXLUHVXUJHQW PDLQWHQDQFH &RYHUOLGSURWHFWVRSHQLQJWR VWUXFWXUH /RFNLQJPHFKDQLVP 1RW:RUNLQJ 0HFKDQLVP FDQQRWEHRSHQHGE\RQH PDLQWHQDQFHSHUVRQZLWKSURSHUWRROV%ROWV FDQQRWEHVHDWHG6HOIORFNLQJFRYHUOLGGRHVQRW ZRUN 0HFKDQLVPRSHQVZLWKSURSHUWRROV &RYHUOLGGLIILFXOWWR 5HPRYH 2QHPDLQWHQDQFHSHUVRQFDQQRWUHPRYH FRYHUOLGDIWHUDSSO\LQJOEVRIOLIW &RYHUOLGFDQEHUHPRYHGDQG UHLQVWDOOHGE\RQHPDLQWHQDQFH SHUVRQ 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &219(<$1&( 3,3(6$1'',7&+(6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 3LSHV 6HGLPHQW GHEULV DFFXPXODWLRQ $FFXPXODWHGVHGLPHQWRUGHEULVWKDWH[FHHGV RIWKHGLDPHWHURIWKHSLSH :DWHUIORZVIUHHO\WKURXJKSLSHV 9HJHWDWLRQURRWV 9HJHWDWLRQURRWVWKDWUHGXFHIUHHPRYHPHQWRI ZDWHUWKURXJKSLSHV :DWHUIORZVIUHHO\WKURXJKSLSHV &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP 'DPDJHWRSURWHFWLYH FRDWLQJRUFRUURVLRQ 3URWHFWLYHFRDWLQJLVGDPDJHGUXVWRUFRUURVLRQ LVZHDNHQLQJWKHVWUXFWXUDOLQWHJULW\RIDQ\SDUWRI SLSH 3LSHUHSDLUHGRUUHSODFHG 'DPDJHG $Q\GHQWWKDWGHFUHDVHVWKHFURVVVHFWLRQDUHD RISLSHE\PRUHWKDQRULVGHWHUPLQHGWR KDYHZHDNHQHGVWUXFWXUDOLQWHJULW\RIWKHSLSH 3LSHUHSDLUHGRUUHSODFHG 'LWFKHV 7UDVKDQGGHEULV 7UDVKDQGGHEULVH[FHHGVFXELFIRRWSHU VTXDUHIHHWRIGLWFKDQGVORSHV 7UDVKDQGGHEULVFOHDUHGIURP GLWFKHV 6HGLPHQW DFFXPXODWLRQ $FFXPXODWHGVHGLPHQWWKDWH[FHHGVRIWKH GHVLJQGHSWK 'LWFKFOHDQHGIOXVKHGRIDOO VHGLPHQWDQGGHEULVVRWKDWLW PDWFKHVGHVLJQ 1R[LRXVZHHGV $Q\QR[LRXVRUQXLVDQFHYHJHWDWLRQZKLFKPD\ FRQVWLWXWHDKD]DUGWR&RXQW\SHUVRQQHORUWKH SXEOLF 1R[LRXVDQGQXLVDQFHYHJHWDWLRQ UHPRYHGDFFRUGLQJWRDSSOLFDEOH UHJXODWLRQV1RGDQJHURIQR[LRXV YHJHWDWLRQZKHUH&RXQW\SHUVRQQHO RUWKHSXEOLFPLJKWQRUPDOO\EH &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP 9HJHWDWLRQ 9HJHWDWLRQWKDWUHGXFHVIUHHPRYHPHQWRIZDWHU WKURXJKGLWFKHV :DWHUIORZVIUHHO\WKURXJKGLWFKHV (URVLRQGDPDJHWR VORSHV $Q\HURVLRQREVHUYHGRQDGLWFKVORSH 6ORSHVDUHQRWHURGLQJ 5RFNOLQLQJRXWRI SODFHRUPLVVLQJ,I $SSOLFDEOH 2QHOD\HURUOHVVRIURFNH[LVWVDERYHQDWLYHVRLO DUHDVTXDUHIHHWRUPRUHDQ\H[SRVHGQDWLYH VRLO 5HSODFHURFNVWRGHVLJQVWDQGDUGV 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± *5281'6 /$1'6&$3,1* 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 6LWH 7UDVKRUOLWWHU $Q\WUDVKDQGGHEULVZKLFKH[FHHGFXELFIRRW SHUVTXDUHIHHWWKLVLVDERXWHTXDOWRWKH DPRXQWRIWUDVKLWZRXOGWDNHWRILOOXSRQH VWDQGDUGVL]HRIILFHJDUEDJHFDQ,QJHQHUDO WKHUHVKRXOGEHQRYLVXDOHYLGHQFHRIGXPSLQJ 7UDVKDQGGHEULVFOHDUHGIURPVLWH 1R[LRXVZHHGV $Q\QR[LRXVRUQXLVDQFHYHJHWDWLRQZKLFKPD\ FRQVWLWXWHDKD]DUGWR&RXQW\SHUVRQQHORUWKH SXEOLF 1R[LRXVDQGQXLVDQFHYHJHWDWLRQ UHPRYHGDFFRUGLQJWRDSSOLFDEOH UHJXODWLRQV1RGDQJHURIQR[LRXV YHJHWDWLRQZKHUH&RXQW\SHUVRQQHO RUWKHSXEOLFPLJKWQRUPDOO\EH &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP *UDVVJURXQGFRYHU *UDVVRUJURXQGFRYHU H[FHHGVLQFKHVLQ KHLJKW *UDVVRUJURXQGFRYHUPRZHGWRD KHLJKWQRJUHDWHUWKDQLQFKHV 7UHHVDQG6KUXEV +D]DUG $Q\WUHHRUOLPERIDWUHHLGHQWLILHGDVKDYLQJD SRWHQWLDOWRIDOODQGFDXVHSURSHUW\GDPDJHRU WKUHDWHQKXPDQOLIH$KD]DUGWUHHLGHQWLILHGE\ DTXDOLILHGDUERULVWPXVWEHUHPRYHGDVVRRQ DVSRVVLEOH 1RKD]DUGWUHHVLQIDFLOLW\ 'DPDJHG /LPEVRUSDUWVRIWUHHVRUVKUXEVWKDWDUHVSOLWRU EURNHQZKLFKDIIHFWPRUHWKDQRIWKHWRWDO IROLDJHRIWKHWUHHRUVKUXE 7UHHVDQG VKUXEVZLWKOHVVWKDQ RIWRWDOIROLDJHZLWKVSOLWRUEURNHQ OLPEV 7UHHVRUVKUXEVWKDWKDYHEHHQEORZQGRZQRU NQRFNHGRYHU 1REORZQGRZQYHJHWDWLRQRU NQRFNHGRYHUYHJHWDWLRQ7UHHVRU VKUXEVIUHHRILQMXU\ 7UHHVRUVKUXEVZKLFKDUHQRWDGHTXDWHO\ VXSSRUWHGRUDUHOHDQLQJRYHUFDXVLQJH[SRVXUH RIWKHURRWV 7UHHRUVKUXELQSODFHDQG DGHTXDWHO\VXSSRUWHGGHDGRU GLVHDVHGWUHHVUHPRYHG 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ APPENDIX G: BOND QUANTITIES WORKSHEET 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW6:HEGDWHDepartment of Permitting & Environmental Review35030 SE Douglas Street, Suite 210Snoqualmie, Washington 98065-9266206-296-6600 TTY Relay 7113URMHFW1DPH'DWH/RFDWLRQ3URMHFW1R$FWLYLW\1R1RWH$OOSULFHVLQFOXGHODERUHTXLSPHQWPDWHULDOVRYHUKHDGDQG&OHDULQJJUHDWHUWKDQRUHTXDOWRERDUGIHHWRIWLPEHU"SURILW3ULFHVDUHIURP560HDQVGDWDDGMXVWHGIRUWKH6HDWWOHDUHDRUIURPORFDOVRXUFHVLIQRWLQFOXGHGLQWKH560HDQVGDWDEDVH\HV[QR,I\HV)RUHVW3UDFWLFH3HUPLW1XPEHU5&:3DJHRI-XPS6WDUW(VSUHVVR6:WK6WUHHW)HGHUDO:D\:$)RUDOWHUQDWHIRUPDWVFDOOBBBBBBBBBBBBBBBBBB&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW6:HEGDWH8QLW RI5HIHUHQFH 3ULFH 8QLW 4XDQWLW\ $SSOLFDWLRQV &RVW(526,216(',0(17&21752/1XPEHU%DFNILOO FRPSDFWLRQHPEDQNPHQW(6& &<&KHFNGDPVPLQXVURFN(6&6:'0 (DFK &UXVKHGVXUIDFLQJPLQXV(6&:6'27 &<'LWFKLQJ(6& &< ([FDYDWLRQEXON(6& &<)HQFHVLOW(6&6:'0 /) )HQFH7HPSRUDU\1*3((6& /)+\GURVHHGLQJ(6&6:'0 6< -XWH0HVK(6&6:'0 6<0XOFKE\KDQGVWUDZGHHS(6&6:'0 6<0XOFKE\PDFKLQHVWUDZGHHS(6&6:'0 6<3LSLQJWHPSRUDU\&33(6& /)3LSLQJWHPSRUDU\&33(6& /)3LSLQJWHPSRUDU\&33(6& /)3ODVWLFFRYHULQJPPWKLFNVDQGEDJJHG(6&6:'0 6<5LS5DSPDFKLQHSODFHGVORSHV(6&:6'27 &<5RFN&RQVWUXFWLRQ(QWUDQFH [ [ (6&6:'0 (DFK 5RFN&RQVWUXFWLRQ(QWUDQFH [ [ (6&6:'0 (DFK 6HGLPHQWSRQGULVHUDVVHPEO\(6&6:'0 (DFK6HGLPHQWWUDS KLJKEHUP(6&6:'0 /)6HGWUDS KLJKULSUDSSHGVSLOOZD\EHUPVHFWLRQ(6&6:'0 /)6HHGLQJE\KDQG(6&6:'0 6<6RGGLQJGHHSOHYHOJURXQG(6&6:'0 6<6RGGLQJGHHSVORSHGJURXQG(6&6:'0 6<7(6&6XSHUYLVRU(6& +5:DWHUWUXFNGXVWFRQWURO(6&6:'0 +5:5,7(,1,7(06 VHHSDJH(DFK(6&68%727$/&217,1*(1&< 02%,/,=$7,21(6&727$/&2/801$3DJHRI &RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH([LVWLQJ )XWXUH3XEOLF 3ULYDWH5LJKWRI:D\ 5LJKWRI:D\ ,PSURYHPHQWV8QLW3ULFH 8QLW 4XDQW &RVW 4XDQW &RVW 4XDQW &RVW*(1(5$/,7(061R%DFNILOO &RPSDFWLRQHPEDQNPHQW *, &< %DFNILOO &RPSDFWLRQWUHQFK *, &<&OHDU5HPRYH%UXVKE\KDQG *, 6<&OHDULQJ*UXEELQJ7UHH5HPRYDO *, $FUH ([FDYDWLRQEXON *, &< ([FDYDWLRQ7UHQFK *, &<)HQFLQJFHGDU KLJK *, /))HQFLQJFKDLQOLQNYLQ\OFRDWHG KLJK *, /))HQFLQJFKDLQOLQNJDWHYLQ\OFRDWHG*, (DFK)HQFLQJVSOLWUDLO KLJK *, /))LOO FRPSDFWFRPPRQEDUURZ *, &<)LOO FRPSDFWJUDYHOEDVH *, &<)LOO FRPSDFWVFUHHQHGWRSVRLO *, &<*DELRQGHHSVWRQHILOOHGPHVK *, 6<*DELRQGHHSVWRQHILOOHGPHVK *, 6<*DELRQGHHSVWRQHILOOHGPHVK *, 6<*UDGLQJILQHE\KDQG *, 6<*UDGLQJILQHZLWKJUDGHU *, 6<0RQXPHQWV ORQJ *, (DFK 6HQVLWLYH$UHDV6LJQ *, (DFK6RGGLQJGHHSVORSHGJURXQG *, 6<6XUYH\LQJOLQH JUDGH *, 'D\6XUYH\LQJORWORFDWLRQOLQHV *, $FUH7UDIILFFRQWUROFUHZIODJJHUV *, +57UDLOFKLSSHGZRRG *, 6<7UDLOFUXVKHGFLQGHU *, 6<7UDLOWRSFRXUVH *, 6<:DOOUHWDLQLQJFRQFUHWH *, 6) :DOOURFNHU\ *, 6)3DJHRI 68%727$/ 'UDLQDJH)DFLOLWLHV .&&$DXWKRUL]HVRQO\RQHERQGUHGXFWLRQ&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH([LVWLQJ )XWXUH3XEOLF5LJKWRIZD\ 5LJKWRI:D\ ,PSURYHPHQWV8QLW3ULFH 8QLW 4XDQW &RVW 4XDQW &RVW 4XDQW &RVW52$',03529(0(171R$&*ULQGLQJ ZLGHPDFKLQHV\ 5, 6<$&*ULQGLQJ ZLGHPDFKLQH5, 6<$&*ULQGLQJ ZLGHPDFKLQH!V\ 5, 6<$&5HPRYDO'LVSRVDO 5, 6<%DUULFDGHW\SH,,,3HUPDQHQW 5, /)&XUE *XWWHUUROOHG 5, /) &XUE *XWWHUYHUWLFDO 5, /) &XUEDQG*XWWHUGHPROLWLRQDQGGLVSRVDO 5, /)&XUEH[WUXGHGDVSKDOW 5, /)&XUEH[WUXGHGFRQFUHWH 5, /) 6DZFXWDVSKDOWGHSWK 5, /) 6DZFXWFRQFUHWHSHUGHSWK 5, /)6HDODQWDVSKDOW 5, /) 6KRXOGHU$&VHH$&URDGXQLWSULFH 5, 6<6KRXOGHUJUDYHOWKLFN 5, 6<6LGHZDONWKLFN 5, 6< 6LGHZDONWKLFNGHPROLWLRQDQGGLVSRVD5, 6< 6LGHZDONWKLFN 5, 6< 6LGHZDONWKLFNGHPROLWLRQDQGGLVSRVD5, 6<6LJQKDQGLFDS 5, (DFK 6WULSLQJSHUVWDOO 5, (DFK6WULSLQJWKHUPRSODVWLFIRUFURVVZDON 5, 6) 6WULSLQJUHIOHFWRUL]HGOLQH 5, /)3DJHRI 68%727$/ 3ULYDWH 'UDLQDJH)DFLOLWLHV .&&$DXWKRUL]HVRQO\RQHERQGUHGXFWLRQ&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH([LVWLQJ )XWXUH3XEOLF 3ULYDWH5LJKWRIZD\ 5LJKWRI:D\ ,PSURYHPHQWV8QLW3ULFH 8QLW 4XDQW &RVW 4XDQW &RVW 4XDQW &RVW52$'685)$&,1*1R5RFN EDVH WRSFRXUVH5RFN EDVH WRSFRXUVH$GGLWLRQDO&UXVKHG6XUIDFLQJ 56 6< +0$2YHUOD\ 56 6<+0$2YHUOD\ 56 6<+0$5RDGURFN)LUVW6< 56 6<+0$5RDGURFN4W\RYHU6<56 6<+0$5RDG5RFN)LUVW6<56 6<+0$5RDG5RFN4W\2YHU56 6<1RW8VHG 561RW8VHG 56+0$5RDG'HSWK)LUVW6< 56 6< +0$5RDG'HSWK4W\2YHU6<56 6<+0$RU'HSWK 56 6<*UDYHO5RDGURFN)LUVW6< 56 6<*UDYHO5RDGURFN4W\RYHU6< 56 6<3&&5RDG$GG8QGHU:ULWH,QVZ'HVLJ567KLFNHQHG(GJH 56 /)3DJHRI 68%727$/ 'UDLQDJH)DFLOLWLHV .&&$DXWKRUL]HVRQO\RQHERQGUHGXFWLRQ&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH([LVWLQJ )XWXUH3XEOLF 3ULYDWH5LJKWRIZD\ 5LJKWRI:D\ ,PSURYHPHQWV8QLW3ULFH 8QLW 4XDQW &RVW 4XDQW &RVW 4XDQW &RVW'5$,1$*(&33 &RUUXJDWHG3ODVWLF3LSH1RU(TXLYDOHQW$FFHVV5RDG5' ' 6< %ROODUGVIL[HG ' (DFK%ROODUGVUHPRYDEOH ' (DFK &%VLQFOXGHIUDPHDQGOLG&%7\SH, ' (DFK &%7\SH,/ ' (DFK&%7\SH,,GLDPHWHU ' (DFK IRUDGGLWLRQDOGHSWKRYHU ' )7 &%7\SH,,GLDPHWHU ' (DFK IRUDGGLWLRQDOGHSWKRYHU ' )7&%7\SH,,GLDPHWHU ' (DFKIRUDGGLWLRQDOGHSWKRYHU ' )7&%7\SH,,GLDPHWHU ' (DFKIRUDGGLWLRQDOGHSWKRYHU ' )77KURXJKFXUE,QOHW)UDPHZRUN$GG ' (DFK&OHDQRXW39& ' (DFK&OHDQRXW39& ' (DFK &OHDQRXW39& ' (DFK &XOYHUW39& ' /)&XOYHUW39& ' /)&XOYHUW39& ' /)&XOYHUW39& ' /) &XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)&XOYHUW&03 ' /)3DJHRI 68%727$/ 'UDLQDJH)DFLOLWLHV)RU&XOYHUWSULFHV$YHUDJHRI FRYHUZDVDVVXPHG$VVXPHSHUIRUDWHG39&LVVDPHSULFHDVVROLGSLSH .&&$DXWKRUL]HVRQO\RQHERQGUHGXFWLRQ&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH([LVWLQJ )XWXUH3XEOLF 3ULYDWH5LJKWRIZD\ 5LJKWRI:D\ ,PSURYHPHQWV'5$,1$*(&217,18('1R 8QLW3ULFH 8QLW 4XDQW &RVW 4XDQW &RVW 4XDQW &RVW&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&RQFUHWH ' /)&XOYHUW&33 ' /)&XOYHUW&33 ' /)&XOYHUW&33 ' /) &XOYHUW&33 ' /) &XOYHUW&33 ' /)&XOYHUW&33 ' /) &XOYHUW&33 ' /)&XOYHUW&33 ' /)'LWFKLQJ ' &<)ORZ'LVSHUVDO7UHQFKEDVH ' /))UHQFK'UDLQ GHSWK ' /)*HRWH[WLOHODLGLQWUHQFKSRO\SURS\OHQH ' 6<0LGWDQN$FFHVV5LVHUGLD GHHS ' (DFK3RQG2YHUIORZ6SLOOZD\ ' 6<5HVWULFWRU2LO6HSDUDWRU ' (DFK5HVWULFWRU2LO6HSDUDWRU ' (DFK5HVWULFWRU2LO6HSDUDWRU ' (DFK 5LSUDSSODFHG ' &< 7DQN(QG5HGXFHUGLDPHWHU ' (DFK7UDVK5DFN ' (DFK7UDVK5DFN ' (DFK7UDVK5DFN ' (DFK7UDVK5DFN ' (DFK3DJHRI 68%727$/ 'UDLQDJH)DFLOLWLHV .&&$DXWKRUL]HVRQO\RQHERQGUHGXFWLRQ&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH([LVWLQJ )XWXUH3XEOLF 3ULYDWH5LJKWRIZD\ 5LJKWRI:D\ ,PSURYHPHQWV8QLW3ULFH 8QLW 4XDQW 3ULFH 4XDQW &RVW 4XDQW &RVW3$5.,1*/27685)$&,1*1R$&WRSFRXUVHURFN ERUURZ 3/ 6< 1$ 1$ $&WRSFRXUVH EDVHFRXUV3/ 6< 1$ 1$VHOHFWERUURZ 3/ 6< 1$ 1$WRSFRXUVHURFN EDVHFRXUVH 3/ 6< 1$ 1$87,/,7<32/(6 675((7/,*+7,1*8WLOLW\SROHUHORFDWLRQFRVWVPXVWEHDFFRPSDQLHGE\)UDQFKLVH8WLOLW\ V&RVW(VWLPDWH8WLOLW\3ROHV5HORFDWLRQ 836WUHHW/LJKW3ROHVZ/XPLQDLUHV 83 (DFK :5,7(,1,7(066XFKDVGHWHQWLRQZDWHUTXDOLW\YDXOWV1R6WRUPZDWHU9DXOW :, (DFK %ORFN:DOO :, 6<<DUG'UDLQ :, (DFK :, /):, )7:,:,:,:,:,68%727$/68%727$/680$//3$*(6 &217,1*(1&< 02%,/,=$7,21 *5$1'727$/ &2/801 % & '3DJHRI/XPS6XP 'UDLQDJH)DFLOLWLHV1RW7R%H8VHG)RU5RDGV2U6KRXOGHUV .&&$DXWKRUL]HVRQO\RQHERQGUHGXFWLRQ&RVW(VWLPDWH[OV8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH 6LWH,PSURYHPHQW%RQG4XDQWLW\:RUNVKHHW:HEGDWH2ULJLQDOERQGFRPSXWDWLRQVSUHSDUHGE\1DPH'DWH3(5HJLVWUDWLRQ1XPEHU7HO)LUP1DPH$GGUHVV3URMHFW1R6WDELOL]DWLRQ(URVLRQ6HGLPHQW&RQWURO(6& $([LVWLQJ5LJKWRI:D\,PSURYHPHQWV %)XWXUH3XEOLF5LJKWRI:D\ 'UDLQDJH)DFLOLWLHV &3ULYDWH,PSURYHPHQWV '&DOFXODWHG4XDQWLW\&RPSOHWHG7RWDO5LJKWRI:D\DQGRU6LWH5HVWRUDWLRQ%RQG $%)LUVWRIERQG VKDOOEHFDVK3HUIRUPDQFH%RQG $PRXQW $%&' 727$/ 7 7[0LQLPXPLV 0LQLPXPLV0DLQWHQDQFH'HIHFW%RQG 7RWDO0LQLPXPLV1$0(2)3(562135(3$5,1*%21' 5('8&7,21'DWH 127(7KHZRUGERQGDVXVHGLQWKLVGRFXPHQWPHDQVDILQDQFLDOJXDUDQWHHDFFHSWDEOHWR.LQJ&RXQW\ 127(.&&$DXWKRUL]HVULJKWRIZD\DQGVLWHUHVWRUDWLRQERQGVWREHFRPELQHGZKHQERWKDUHUHTXLUHG7KHUHVWRUDWLRQUHTXLUHPHQWVKDOOLQFOXGHWKHWRWDOFRVWIRUDOO7(6&DVDPLQLPXPQRWDPD[LPXP,QDGGLWLRQFRUUHFWLYHZRUNERWKRQDQGRIIVLWHQHHGVWREHLQFOXGHG4XDQWLWLHVVKDOOUHIOHFWZRUVHFDVHVFHQDULRVQRWMXVWPLQLPXPUHTXLUHPHQWV)RUH[DPSOHLIDVDOPRQLGVWUHDPPD\EHGDPDJHGVRPHHVWLPDWHGFRVWVIRUUHVWRUDWLRQQHHGVWREHUHIOHFWHGLQWKLVDPRXQW7KHFRQWLQJHQF\DQGPRELOL]DWLRQFRVWVDUHFRPSXWHGLQWKLVTXDQWLW\ 127(3HU.&&$WRWDOERQGDPRXQWVUHPDLQLQJDIWHUUHGXFWLRQVKDOOQRWEHOHVVWKDQRIWKHRULJLQDODPRXQW7RUDVUHYLVHGE\PDMRUGHVLJQFKDQJHV5(48,5('%21' $028176$5(68%-(&7725(9,(:$1'02',),&$7,21%<.,1*&2817<),1$1&,$/*8$5$17((5(48,5(0(17638%/,&52$' '5$,1$*(0$,17(1$1&('()(&7%21' $GDP(3DXO$3&RQVXOWLQJ(QJLQHHUV3//&32%R[$XEXUQ:$3(5)250$1&(%21' $028170,1,080%21' $028175(48,5(')255(&25',1*257(0325$5<2&&83$1&<$768%67$17,$/&203/(7,21 %&[ 3DJHRI&RVW(VWLPDWH[OVCheck out the DDES Web site at www.kingcounty.gov/permits8QLWSULFHVXSGDWHG9HUVLRQ5HSRUW'DWH APPENDIX H: SOURCE CONTROL MEASURES Stormwater Pollution Prevention Manual • King County 27 A-1 Required Best Management Practices for all Properties with Commercial Activities The following Best Management Practices (BMPs) are required for all commercial, industrial, agricultural, public, or residential properties with commercial activities in unincorporated King County. Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: Clean and Maintain Storm Drainage System • Evaluate the condition of the catch basin by checking the amount of sediment in the bottom of the sump. Catch basins must be cleaned out when the solids, trash, and debris in the sump reaches one–half of the depth between the bottom of the sump and the bottom of the lowest inflow or outflow pipe connected to the catch basin or is at least 6 inches below this point. • Hire a professional drainage contractor to inspect and maintain your system or clean the system yourself. If there is sediment or other debris in the drainage pipes, then a professional contractor must be hired to flush or jet out the pipes. • Small amounts of floating oil can be soaked up with oil absorbent pads, bagged and disposed of as solid waste. • Up to one cubic yard of nonhazardous solid material may be disposed of as solid waste in your regular garbage. If you exceed this threshold hire a professional drainage contractor. All of the solids and stagnant water collected from catch basin sumps must be disposed of properly. None of the sump contents can be flushed into the catch basin outflow pipe. Depending on the nature of the pollutants in the sump, and the associated types of activities taking place on the site, the sump contents may need to be handled as contaminated waste. Contractors who perform catch basin clean–out services are required to follow appropriate disposal requirements. • Clean and maintain catch basins annually. Sites with activities generating a lot of sediments and other debris will have to inspect and clean out their catch basins more often. Frequent sweeping of paved parking and storage areas will save time and money in maintaining the drainage system. • Other components of drainage systems such as ponds, tanks, and bioswales must also be maintained. If this maintenance is beyond your ability, contractors are available to complete this work. Label All Storm Drain Inlets on Your Property • Stencil or apply storm drain markers adjacent to storm drains to help prevent the improper disposal of pollutants. If the storm drain grate is stamped with warnings against polluting, then additional marking may not be required if there is no evidence of pollutants being dumped or washed into the storm drain. Stormwater Pollution Prevention Manual • King County28 Eliminate Illicit Connections to the Storm Drainage System • Connections to the storm drainage system that convey substances other than stormwater are prohibited. Examples are connections from internal floor drains, HVAC systems, industrial processes, sinks, and toilets. • Illicit connections must be immediately removed, permanently plugged or re–plumbed. • The discharge must be re–plumbed so that it goes to the sanitary sewer, a septic system, an on–site treatment system, or a holding tank for off–site disposal. There are restrictions on what can be disposed of to the sanitary sewer and septic systems. You may be required to do additional investigation to determine where all stormwater and non–stormwater discharges go. This may include smoke, dye, and chemical testing or closed circuit television inspection. Additional Information: • Drainage System Maintenance Contractors Information Sheet • For stencils and instructions or to determine if you have an illicit connection, contact King County Stormwater Services at 206–477–4811 or kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County42 A-15 Pressure Washing of Buildings, Rooftops, and Other Large Objects Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • If the area is paved and soaps, detergents or any other chemical (including pesticides) are used, use a sump pump, wet vacuum or similar device that enables collection of wash water and associated solids so they can be disposed of properly. The wash water must not go to the storm drain system. • If the area is paved but soaps and detergents are not being used, the wash water runoff does not have to be collected but it does have to be filtered to trap solid materials. • The wash water does not need to be collected if the area is landscaped and the water can soak into the ground without running into the storm drain system. • If the surface being pressure washed is painted with lead or other heavy metal–bearing paint (such as chromium or cadmium), you must use a commercial pressure washing service that will collect, test, and properly dispose of the wastewater. • Block or disconnect all rooftop downspouts when washing roofs. The wash/waste water must be directed to pervious areas such as landscaping or gravel for infiltration, collected and disposed of to the sanitary sewer, or taken off site for appropriate disposal. Additional Information: • Disposal Information sheet • Catch basin insert Information sheet Note: Pressure washing of boats in boat yards, marinas, and dry dock areas is covered by a National Pollutant Discharge Elimination System (NPDES) permit, administered by the Washington State Department of Ecology, so the BMPs listed above may not apply to pressure washing in these locations. For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County56 A-26 Landscaping Activities and Vegetation Management Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Train employees on the proper use and application of fertilizers and pesticides. • Never apply pesticides and fertilizers if it is raining or about to rain. • Do not apply pesticides within 100 feet of surface waters such as lakes, ponds, wetlands, streams, and stormwater conveyance ditches unless the application is approved and permitted by the Washington State Department of Ecology. • Determine the proper fertilizer application for the types of soil and vegetation involved. Follow manufacturers’ recommendations and label directions. • Clean up any spills immediately. • Remove weeds/vegetation in stormwater ditches by hand or other mechanical means and only use chemicals as a last resort. • Do not blow vegetation or other debris into the storm drain system, sidewalks, or street. Dispose of collected vegetation by recycling or composting. • Use mulch or other erosion control measures when soils are exposed for more than one week during the dry season or two days during the rainy season. • Ensure sprinkler systems do not “overspray” vegetated areas resulting in the excess water discharging into the storm drain system. • New and expanding golf courses must have a Golf Course Management Plan as described in addressed in the King County Golf Course BMP Manual Supplemental BMPs: • Use integrated pest management (IPM); a comprehensive approach to the use of pesticides is the most effective BMP measure that can be taken for herbicide, insecticide, and fungicide use. • Test soils to determine the correct fertilizer application rates. • Use mechanical methods of vegetation removal rather than applying herbicides. • Use native plants in landscaping. Native plants do not require extensive fertilizer or pesticide applications. Stormwater Pollution Prevention Manual • King County 57 Additional Information: • Storage of Pesticides and Fertilizers – Activity Sheets A-5 • Natural Yard Care Program: http://your.kingcounty.gov/solidwaste/naturalyardcare/watering.asp • The King County Golf Course BMP Manual. • The King County Noxious Weed Control Program provides best management practices for the removal of typical noxious weeds such as blackberry and purple loosestrife. Call 206–296–0290 or see: http://www.kingcounty.gov/environment/animalsandplants/noxious–weeds/weed–control–practices.aspx for more information. Washington pesticide law requires most businesses that commercially apply pesticides to the property of another to be licensed as a Commercial Applicator from the Washington State Department of Agriculture. For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County58 A-27 Clearing and Grading of Land for Small Construction Projects Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: Contact the King County Department of Design and Environmental Review (DPER) prior to clearing, grading, and preparation activities for construction sites greater than 2,000 square feet. Follow the procedures for construction site erosion and sediment control outlined in the King County Surface Water Design Manual, Appendix D Erosion and Sediment Control Standards. King County DPER coordinates the clearing, grading, and erosion control requirements on individual sites. The King County Surface Water Design Manual has requirements for erosion and sediment control measures. Appendix D (Erosion and Sediment Control Standards) outlines requirements that all sites must implement. The King County Surface Water Design Manual Appendix C (Small Project Drainage Requirements) addresses small project developments. Even if your site does not require a permit, erosion control measures are still required to prevent turbid water from entering drainage systems or surface waters. For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County 59 A-28 Demolition of Buildings Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Sweep surrounding street gutters, sidewalks, driveways, and other paved surfaces as needed to collect loose debris and garbage. Properly dispose of collected debris and garbage. Do not hose down the area to a storm drain. • Handle and dispose of all waste materials and demolition debris in a manner that does not cause contamination of stormwater. • Control dust and fine material using water or dust suppression products, avoiding excessive application to prevent runoff. • Install catch basin inserts to prevent particles and solids from entering the storm drainage system. • Inspect and maintain catch basin inserts to ensure they are working correctly. Additional Information: • Catch Basin Insert Information Sheet • Surface Water Design Manual Construction and Erosion BMPs Appendix D For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County 63 A-31 Vehicle and Equipment Parking and Storage Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Sweep parking lots, storage areas, and driveways as needed to collect dirt, waste, and debris. Do not hose down the area to the storm drainage system. • Clean up vehicle and equipment fluid drips and spills immediately. • Place drip pans below inoperative or leaking vehicles and equipment, including employee vehicles. • Collect and discharge wash water to a sanitary sewer or haul for offsite disposal if washing/pressure washing of the parking lot occurs. There are businesses that will clean parking lots and collect water for off–site disposal. Never drain wash water to the storm drainage system. • Follow basic sediment controls as outlined in Appendix D (“Erosion and Sediment Control Standards”) of the King County Surface Water Design Manual for gravel and dirt lots. These types of parking lots may require additional BMPs to prevent sediment laden water from leaving your site. Supplemental BMPs: • Encourage employees to repair leaking personal vehicles. • Encourage employees to carpool or use public transit through incentives. • Encourage customers to use public transit by rewarding valid transit pass holders with discounts. • Install catch basin inserts to collect excess sediment and oil if necessary. Inspect and maintain catch basin inserts to ensure they are working correctly. Additional Information: • Disposal Information Sheet • Catch Basin Insert Information Sheet For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County64 A-32 Sidewalk Maintenance Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Sweep sidewalks as needed to collect loose dirt and debris rather than blowing or pushing it into the street or gutter or hosing it down. Collected materials must be disposed of as solid waste. • Clean individual stains instead of washing the entire sidewalk if possible. • Collect wash water and dispose of into the sanitary sewer or take off site for appropriate disposal if soaps or other cleaners are used. If only water is used, install a catch basin insert or filter cloth in order to collect all solids and debris. • Use a minimum amount of sand or deicing salts and sweep up any remaining granules when the snow and ice have melted. Additional Information: • Disposal Information Sheet • Storage of Liquid Materials in Portable Containers – See Activity Sheet A-3 • Containment Information Sheet For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater.