The URL can be used to link to this page

20-105047-UP-TECHNICAL INFORMATION REPORT-12.29.2020-V1 TABLE OF CONTENTS PAGE 1.0 PROJECT OVERVIEW 1 2.0 CONDITIONS AND REQUIREMENTS SUMMARY 1 3.0 OFF-SITE ANALYSIS 4 4.0 FLOW CONTROL AND WATER QUALITY FACILITY ANALYSIS AND DESIGN 4 5.0 CONVEYANCE SYSTEM ANALYSIS AND DESIGN 6 6.0 SPECIAL REPORTS AND STUDIES 6 7.0 OTHER PERMITS 6 8.0 ESC ANALYSIS AND DESIGN 6 9.0 BOND QUANTITIES, FACILITY SUMMARIES, AND DECLARATION OF COVENANT 7 10.0 OPERATIONS AND MAINTENANCE MANUAL 7 TABLE OF APPENDICES APPENDIX SOIL INFORMATION A MAPS & EXHIBITS B TIR WORKSHEET & STORMWATER ANALYSIS C OFFSITE ANALYSIS D OTHER SPECIAL REPORTS E OPERATION AND MAINTENANCE MANUAL F BOND QUANTITIES WORKSHEET G SOURCE CONTROL MEASURES H 1 JUMP START ESPRESSO TECHNICAL INFORMATION REPORT 1.0 PROJECT OVERVIEW This project will be located on parcel number 1321039067 at 3450 SW 320th Street. This project will be constructed on approximately 0.44 acres and is located in the Dumas Bay drainage basin. The project will comply with the 2016 King County Surface Water Design Manual (KCSWDM) and the Federal Way Addendum. The pre-developed site consists of one parcel and contains no building on site. An existing public conveyance system is located in SW 320th Street. Stormwater runoff from the existing site currently discharges into this system and will continue to discharge here after construction of this project is complete. The completed project will consist of a new 614 square-foot commercial building, a stormwater pond on the west side of the property, and a water quality treatment system. Additionally, the project will require sewer and water service connections to serve the new building. Runoff from the project will be conveyed to the new stormwater detention pond and then will be discharged into the existing conveyance system to the southwest of the project site. No significant impacts are anticipated to the downstream system because developed flows will be restricted to match historic durations and peak flows. No significant impacts are anticipated to the Jump Start Espresso property from any runoff from adjacent properties. 2.0 CONDITIONS AND REQUIREMENTS SUMMARY The existing cover on the site consists of lawn. Slopes vary across the site and are fairly shallow but appear to indicate any stormwater surface flow would travel primarily to the south. Existing stormwater runoff from this site leaves the property by sheet flowing across the existing vegetation and is eventually collected in stormwater conveyance systems along 320th Street. On-site soils are identified in the King County Soil Survey as Everett very gravelly sandy loam (hydrologic soil group A). The geotechnical memo prepared by Geotech Consultants, Inc., dated November 14, 2016, identifies the soils as gravelly silty sand. The project will require full drainage review because it will result in more than 2,000 square feet of new impervious surface and does not qualify for Simplified Site Drainage Review. Core Requirements 1 through 9 and Special Requirements 1 through 5 have been addressed in this report, as follows: 2 Core Requirement #1: Discharge at the Natural Location Under existing conditions stormwater runoff sheet flows across the property lines to the south and enters the public conveyance system. Under developed conditions stormwater from the site will continue to be released into the public conveyance system after exiting the on-site detention facility. Core Requirement #2: Off-site Analysis A downstream analysis was included in Section 3 of this report. Core Requirement #3: Flow Control Facilities This project is in the Conservation Flow Control area and Level 2 Flow Control is required. Developed discharge durations will match predeveloped discharge rates from 50% of the 2-year peak flow up to the full 50-year peak flow in accordance with minimum required performance standards for Level 2 Conservation flow control. The developed peak discharge rates will also match predeveloped peak discharge rates for the 2- and 10-year return periods. Core Requirement #4: Conveyance System All new conveyance pipes will be analyzed to show the following: 1. The conveyance system has sufficient capacity to convey and contain (at minimum) the 25-year peak flow, assuming developed conditions for on-site tributary areas and existing conditions for any off-site tributary areas. 2. The 100-year peak flow to the existing system will not create or aggravate a “severe flooding problem” or “severe erosion problem” as defined in Core Requirement #2 and that any overflow occurring on-site for runoff events up to and including the 100-year event discharges at the natural location for the project site. Core Requirement #5: Erosion and Sediment Control Erosion and sedimentation control has been designed per Appendix D of the 2016 KCSWDM. Core Requirement #6: Maintenance and Operations An operation and maintenance manual is included in Appendix F. Core Requirement #7: Financial Guarantees and Liability A bond quantities worksheet is included in Appendix G. Core Requirement #8: Water Quality This project requires Enhanced Basic Water Quality Treatment per 2016 KCSWDM. Enhanced basic water quality treatment will be provided in an underground water quality treatment device. 3 Core Requirement #9: Flow Control BMPs This project will implement flow control BMPs in accordance with Section 1.2.9.2.1 which applies to projects that have an area of less than 22,000 square feet. Special Requirement #1: Other Adopted Area-Specific Requirements None known. Special Requirement #2: Flood Hazard Area Delineation This requirement will not apply to this project because there are no known floodplains or floodways on the property Special Requirement #3: Flood Protection Facilities This requirement will not apply to this project the project does not contain nor is adjacent to a stream that has an existing flood protection facility and also does not propose to construct a new or to modify an existing flood protection facility. Special Requirement #4: Source Controls Water quality source controls that are applicable to this project from the King County Stormwater Pollution Control Manual have been included in Appendix H. Special Requirement #5: Oil Controls This requirement will not apply to this project proposed use does not qualify the finished development as a high-use site. 3.0 OFF-SITE ANALYSIS Downstream Basin of Threshold Discharge Area: A Level 1 downstream analysis was completed for this project in September of 2020. The downstream analysis map is attached in Appendix D. The overall natural slope of the property is towards the south corner of the property and, from there, runoff is collected in the public conveyance system and flows south in a 12” diameter pipe, then continues to the southwest along SW 320th Street in a 30” diameter pipe, then north until it reaches Joes Creek, and continues north until it reaches a quarter of a mile downstream from the project site. No complaints are known to exist from within the last ten years that affect the properties adjacent to the downstream path of the runoff from the project site. From a review of the information available relating to the downstream system, there did not appear to be any existing significant erosion or flooding problems and no 4 significant problems are anticipated to the improvements proposed as part of this project. Upstream Tributary Basin: There are no known concentrated sources of stormwater discharge to this property. 4.0 FLOW CONTROL AND WATER QUALITY FACILITY ANALYSIS AND DESIGN Threshold Discharge Areas and Applicable Requirements for Treatment, Flow Control, and Wetlands Protection There is one threshold discharge area for this project, which encompasses 0.472 acres. The development will include one commercial building, drive aisles, and paved parking with a total impervious area of 0.291 acres and 0.180 acres of landscaping. Predeveloped Site Hydrology As mentioned previously, on-site soils are identified in the King County Soil Survey as Everett very gravelly sandy loam (hydrologic soil group A). The geotechnical memo prepared by Geotech Consultants, Inc., dated November 14, 2016, identifies the soils as gravelly silty sand. Cover characteristics for the existing and historic conditions are as summarized in the table below. PREDEVELOPED CONDITIONS SUB-BASIN FOREST LAWN IMPERVIOUS Project Site 0.472 acres 0.00 acres 0.00 acres Developed Site Hydrology Site cover characteristics for the proposed improvements to this basin are summarized in the table below. DEVELOPED CONDITIONS SUB-BASIN FOREST LAWN IMPERVIOUS Project Site 0.000 acres 0.180 acres 0.291 acres Detailed calculations are included in Appendix C. Performance Standards and Goals This project will provide flow control per Minimum Requirement #7. The detention pond has been designed to match the 2 and 10-year historic peak flow rates and durations for the range of historic flow rates from 50% of the 2-year to the 50-year peak flow rate. 5 The project will provide runoff treatment in compliance with Minimum Requirement #6 since there will be more than 5,000 square feet of effective pollution-generating impervious surface. A GULD-approved BioPod is proposed to provide water quality treatment for the runoff collected from the existing parking lot to meet the enhanced basic water quality requirements for this project. FLOW CONTROL SYSTEM Copies of the detailed calculations are included in Appendix C. Table 1 below provides a summary of the detention analysis results. Table 1: Runoff Summary Return Predeveloped Runoff Rate (CFS) Bypass Release Rate (CFS) Pond Release Rate (CFS) Total Developed Release Rate (CFS) Maximum Water Surface Elevation (FT) 2-year 0.014 0.005 0.006 0.011 200.31 10-year 0.026 0.010 0.012 0.022 200.46 50-year 0.034 0.013 0.022 0.035 201.02 The detention facility is designed to provide a 50-year volume of 9,248 cubic feet at a depth of 4.6 feet. WATER QUALITY SYSTEM On-site stormwater runoff from the proposed project (0.472 acres) will be treated in a Biopod water quality treatment system located upstream of the infiltration facility and will meet the Enhanced Basic Water Quality requirements from Section 6.1.2 of the 2016 KCSWDM. The system has been sized to treat the on-line water quality flow rate as calculated using the current version of WWHM. The required on-line water quality target flow for the Biopod filter, as determined by the current version of WWHM, is 0.046 cfs. The proposed Biopod filter will treat a maximum flow rate of 0.057 cfs. FLOW CONTROL BMPS Section 1.2.9.2 of the KCSWDM requires that a project that must comply with Core Requirement #9 and which is on a lot that has a size smaller than 22,000 square feet must meet the requirements of Section 1.2.9.2.1 of the KCSWDM (Small Lot). Mitigation of New and Replaced Impervious Surface: Full Dispersion: It is infeasible and, therefore, not required for this project to implement the Full Dispersion BMP. Appendix C, Section C.2.1 of the 2016 KCSWDM states that full dispersion BMPs requires a native vegetated flow path segment of at least 100 feet in length and the property does not have any vegetation 6 on the property that would qualify as native vegetation. Full dispersion BMPs are, therefore, not required to be implemented for this project. Full Infiltration: It is infeasible to apply full infiltration BMPs as detailed in Appendix C, Section C.2.2, because coarse sands, cobbles, or medium sands are required and the existing soils on the property were identified by the geotechnical engineer as gravelly silty sand. Limited Infiltration: It is infeasible to apply limited infiltration BMPs as detailed in Appendix C, Section C.2.3, because fine or loamy sands, sandy loams, or loams are required and the existing soils on the property were identified by the geotechnical engineer as gravelly silty sand. Permeable Pavement: It is infeasible to apply permeable pavement BMPs as detailed in Appendix C, Section C.2.7, because the geotechnical engineer did not determine that infiltration was feasible for this property. Bioretention: Bioretention BMPs will be implemented as detailed in Appendix C, Section C.2.6. Because the geotechnical engineer identified on-site soils as gravelly silty sands, the bioretention facilities will be designed to have a volume that is equivalent to 0.6 inches of storage depth over the target impervious areas that can be collected and directed to the bioretention cell proposed in a location to the south of the proposed building. 3,945 square feet of the target impervious surface can be collected and directed to the bioretention cell and at a rate of 0.6 inches per square foot of impervious surface, this would require the bioretention cell to provide a volume of 348 cubic feet. 364 cubic feet of volume will be provided in a bioretention cell at a depth of 12 inches. Bioretention will be used to mitigate 42.39% of the target impervious surfaces. Basic Dispersion: It is infeasible to apply basic dispersion BMPs as detailed in Appendix C, Section C.2.4, because there will not be an adequate amount of vegetated flow path downgradient of the remaining target impervious surfaces that would allow basic dispersion to function as anticipated in the manual. This project will mitigate 42.39% of the project’s target impervious surfaces. Per section 1.2.9.2.1 of the KCSWDM, a project on a lot that has between 11,000 and 22,000 square feet of area is required to mitigate an impervious area equal to 20% of the lot area. This project, therefore, will satisfy this requirement 5.0 CONVEYANCE SYSTEM ANALYSIS AND DESIGN The proposed storm system has been sized appropriately with 12-inch pipes with a minimum slope of 0.59% and analyzed with the Manning’s Equation for the expected site runoff during the 100-year peak flow event. The WWHM analysis indicates that 7 the entire site will have a 100-year peak flow rate of 0.283 cfs and a 12-inch pipe with a minimum slope of 0.59% has a flow capacity of 3.159 cfs and, therefore, is more than adequately sized to handle the flow rates that are anticipated. 6.0 SPECIAL REPORTS AND STUDIES A geotechnical report is included in Appendix E of this report. 7.0 OTHER PERMITS Building permits will be required for the new building and utility service permits will be required for the water service connections and sewer service connection from the Lakehaven Water and Sewer District. 8.0 ESC ANALYSIS AND DESIGN Erosion and sediment control requirements will include the delineation of clearing limits via flagging, proper cover measures for the protection of disturbed areas, perimeter protection with silt fencing, and a stabilized construction entrance per City of Federal Way standards. The Erosion and Sediment Control Plan are included as part of the construction plans. 9.0 BOND QUANTITIES, FACILITY SUMMARIES, AND DECLARATION OF COVENANT The bond quantity worksheet is included in Appendix G. 10.0 OPERATIONS AND MAINTENANCE MANUAL Operations and Maintenance Manual is included in Appendix F. APPENDIX A: SOIL INFORMATION APPENDIX B: MAPS & EXHIBITS APPENDIX C: STORMWATER ANALYSIS WWHM2012 PROJECT REPORT 2019013-Twin Lakes Coffee 10/6/2020 4:39:53 PM Page 2 General Model Information Project Name: 2019013-Twin Lakes Coffee Site Name: Jump Start Espresso Site Address: City: Federal Way, WA Report Date: 10/6/2020 Gage: Seatac Data Start: 1948/10/01 Data End: 2009/09/30 Timestep: 15 Minute Precip Scale: 1.000 Version Date: 2019/09/13 Version: 4.2.17 POC Thresholds Low Flow Threshold for POC1: 50 Percent of the 2 Year High Flow Threshold for POC1: 50 Year 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 3 Landuse Basin Data Predeveloped Land Use Basin 1 Bypass: No GroundWater: No Pervious Land Use acre C, Forest, Flat 0.472 Pervious Total 0.472 Impervious Land Use acre Impervious Total 0 Basin Total 0.472 Element Flows To: Surface Interflow Groundwater 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 4 Mitigated Land Use To Stormwater Pond Bypass: No GroundWater: No Pervious Land Use acre C, Lawn, Flat 0.10602 Pervious Total 0.10602 Impervious Land Use acre ROADS FLAT 0.2053 POND 0.0773 Impervious Total 0.2826 Basin Total 0.38862 Element Flows To: Surface Interflow Groundwater Trapezoidal Pond 1 Trapezoidal Pond 1 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 5 Bypass Bypass: Yes GroundWater: No Pervious Land Use acre C, Lawn, Flat 0.083264 Pervious Total 0.083264 Impervious Land Use acre Impervious Total 0 Basin Total 0.083264 Element Flows To: Surface Interflow Groundwater 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 6 Routing Elements Predeveloped Routing 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 7 Mitigated Routing Trapezoidal Pond 1 Bottom Length: 85.00 ft. Bottom Width: 2.00 ft. Depth: 6 ft. Volume at riser head: 0.1716 acre-feet. Side slope 1: 3 To 1 Side slope 2: 3 To 1 Side slope 3: 3 To 1 Side slope 4: 3 To 1 Discharge Structure Riser Height: 4.6 ft. Riser Diameter: 12 in. Orifice 1 Diameter: 0.3125 in.Elevation:0 ft. Orifice 2 Diameter: 1.125 in. Elevation:3.9 ft. Element Flows To: Outlet 1 Outlet 2 Pond Hydraulic Table Stage(feet) Area(ac.) Volume(ac-ft.) Discharge(cfs) Infilt(cfs) 0.0000 0.003 0.000 0.000 0.000 0.0667 0.004 0.000 0.000 0.000 0.1333 0.005 0.000 0.001 0.000 0.2000 0.006 0.001 0.001 0.000 0.2667 0.007 0.001 0.001 0.000 0.3333 0.008 0.002 0.001 0.000 0.4000 0.008 0.002 0.001 0.000 0.4667 0.009 0.003 0.001 0.000 0.5333 0.010 0.003 0.001 0.000 0.6000 0.011 0.004 0.002 0.000 0.6667 0.012 0.005 0.002 0.000 0.7333 0.013 0.006 0.002 0.000 0.8000 0.014 0.007 0.002 0.000 0.8667 0.014 0.008 0.002 0.000 0.9333 0.015 0.009 0.002 0.000 1.0000 0.016 0.010 0.002 0.000 1.0667 0.017 0.011 0.002 0.000 1.1333 0.018 0.012 0.002 0.000 1.2000 0.019 0.013 0.002 0.000 1.2667 0.020 0.015 0.003 0.000 1.3333 0.021 0.016 0.003 0.000 1.4000 0.022 0.018 0.003 0.000 1.4667 0.023 0.019 0.003 0.000 1.5333 0.024 0.021 0.003 0.000 1.6000 0.025 0.022 0.003 0.000 1.6667 0.026 0.024 0.003 0.000 1.7333 0.027 0.026 0.003 0.000 1.8000 0.028 0.028 0.003 0.000 1.8667 0.029 0.030 0.003 0.000 1.9333 0.030 0.031 0.003 0.000 2.0000 0.031 0.034 0.003 0.000 2.0667 0.032 0.036 0.003 0.000 2.1333 0.033 0.038 0.003 0.000 2.2000 0.034 0.040 0.003 0.000 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 8 2.2667 0.035 0.042 0.004 0.000 2.3333 0.036 0.045 0.004 0.000 2.4000 0.037 0.047 0.004 0.000 2.4667 0.038 0.050 0.004 0.000 2.5333 0.039 0.052 0.004 0.000 2.6000 0.040 0.055 0.004 0.000 2.6667 0.041 0.058 0.004 0.000 2.7333 0.042 0.061 0.004 0.000 2.8000 0.043 0.064 0.004 0.000 2.8667 0.045 0.066 0.004 0.000 2.9333 0.046 0.070 0.004 0.000 3.0000 0.047 0.073 0.004 0.000 3.0667 0.048 0.076 0.004 0.000 3.1333 0.049 0.079 0.004 0.000 3.2000 0.050 0.082 0.004 0.000 3.2667 0.051 0.086 0.004 0.000 3.3333 0.053 0.089 0.004 0.000 3.4000 0.054 0.093 0.004 0.000 3.4667 0.055 0.097 0.004 0.000 3.5333 0.056 0.100 0.005 0.000 3.6000 0.057 0.104 0.005 0.000 3.6667 0.059 0.108 0.005 0.000 3.7333 0.060 0.112 0.005 0.000 3.8000 0.061 0.116 0.005 0.000 3.8667 0.062 0.120 0.005 0.000 3.9333 0.063 0.124 0.011 0.000 4.0000 0.065 0.129 0.016 0.000 4.0667 0.066 0.133 0.019 0.000 4.1333 0.067 0.138 0.022 0.000 4.2000 0.068 0.142 0.024 0.000 4.2667 0.070 0.147 0.026 0.000 4.3333 0.071 0.151 0.028 0.000 4.4000 0.072 0.156 0.029 0.000 4.4667 0.073 0.161 0.031 0.000 4.5333 0.075 0.166 0.033 0.000 4.6000 0.076 0.171 0.034 0.000 4.6667 0.077 0.176 0.218 0.000 4.7333 0.079 0.181 0.546 0.000 4.8000 0.080 0.187 0.946 0.000 4.8667 0.081 0.192 1.357 0.000 4.9333 0.083 0.198 1.724 0.000 5.0000 0.084 0.203 2.002 0.000 5.0667 0.085 0.209 2.181 0.000 5.1333 0.087 0.215 2.344 0.000 5.2000 0.088 0.221 2.484 0.000 5.2667 0.089 0.227 2.617 0.000 5.3333 0.091 0.233 2.744 0.000 5.4000 0.092 0.239 2.865 0.000 5.4667 0.094 0.245 2.981 0.000 5.5333 0.095 0.251 3.093 0.000 5.6000 0.096 0.258 3.200 0.000 5.6667 0.098 0.264 3.304 0.000 5.7333 0.099 0.271 3.405 0.000 5.8000 0.101 0.278 3.504 0.000 5.8667 0.102 0.284 3.599 0.000 5.9333 0.104 0.291 3.692 0.000 6.0000 0.105 0.298 3.783 0.000 6.0667 0.107 0.305 3.871 0.000 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 9 2019013-Twin Lakes Coffee 10/6/2020 4:39:54 PM Page 10 Analysis Results POC 1 + Predeveloped x Mitigated Predeveloped Landuse Totals for POC #1 Total Pervious Area: 0.472 Total Impervious Area: 0 Mitigated Landuse Totals for POC #1 Total Pervious Area: 0.189284 Total Impervious Area: 0.2826 Flow Frequency Method: Log Pearson Type III 17B Flow Frequency Return Periods for Predeveloped. POC #1 Return Period Flow(cfs) 2 year 0.013877 5 year 0.021795 10 year 0.026282 25 year 0.031035 50 year 0.033977 100 year 0.036479 Flow Frequency Return Periods for Mitigated. POC #1 Return Period Flow(cfs) 2 year 0.011246 5 year 0.0174 10 year 0.022176 25 year 0.029045 50 year 0.034791 100 year 0.041096 Annual Peaks Annual Peaks for Predeveloped and Mitigated. POC #1 Year Predeveloped Mitigated 1949 0.014 0.017 1950 0.017 0.019 1951 0.031 0.024 1952 0.010 0.006 1953 0.008 0.007 1954 0.012 0.008 1955 0.019 0.009 1956 0.015 0.017 1957 0.012 0.012 1958 0.014 0.008 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 11 1959 0.012 0.007 1960 0.021 0.013 1961 0.012 0.011 1962 0.007 0.005 1963 0.010 0.009 1964 0.013 0.010 1965 0.009 0.012 1966 0.009 0.008 1967 0.019 0.020 1968 0.012 0.011 1969 0.012 0.012 1970 0.009 0.009 1971 0.010 0.013 1972 0.023 0.022 1973 0.010 0.008 1974 0.011 0.011 1975 0.015 0.013 1976 0.011 0.009 1977 0.001 0.007 1978 0.010 0.008 1979 0.006 0.006 1980 0.022 0.023 1981 0.009 0.008 1982 0.017 0.020 1983 0.015 0.011 1984 0.009 0.007 1985 0.005 0.008 1986 0.024 0.011 1987 0.021 0.012 1988 0.008 0.007 1989 0.005 0.006 1990 0.044 0.036 1991 0.027 0.024 1992 0.010 0.009 1993 0.011 0.007 1994 0.004 0.006 1995 0.015 0.009 1996 0.033 0.022 1997 0.027 0.028 1998 0.006 0.010 1999 0.025 0.028 2000 0.011 0.010 2001 0.002 0.005 2002 0.012 0.017 2003 0.015 0.013 2004 0.019 0.020 2005 0.014 0.011 2006 0.016 0.014 2007 0.033 0.034 2008 0.043 0.024 2009 0.021 0.014 Ranked Annual Peaks Ranked Annual Peaks for Predeveloped and Mitigated. POC #1 Rank Predeveloped Mitigated 1 0.0445 0.0360 2 0.0426 0.0340 3 0.0330 0.0280 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 12 4 0.0325 0.0277 5 0.0306 0.0245 6 0.0272 0.0244 7 0.0268 0.0236 8 0.0255 0.0230 9 0.0241 0.0225 10 0.0228 0.0221 11 0.0216 0.0196 12 0.0213 0.0196 13 0.0209 0.0195 14 0.0207 0.0193 15 0.0194 0.0173 16 0.0191 0.0169 17 0.0189 0.0167 18 0.0170 0.0144 19 0.0166 0.0136 20 0.0164 0.0134 21 0.0154 0.0131 22 0.0152 0.0127 23 0.0152 0.0126 24 0.0150 0.0121 25 0.0149 0.0118 26 0.0139 0.0117 27 0.0138 0.0116 28 0.0136 0.0113 29 0.0131 0.0112 30 0.0122 0.0108 31 0.0120 0.0106 32 0.0118 0.0106 33 0.0118 0.0105 34 0.0118 0.0099 35 0.0117 0.0098 36 0.0115 0.0098 37 0.0112 0.0094 38 0.0110 0.0094 39 0.0108 0.0091 40 0.0107 0.0088 41 0.0103 0.0087 42 0.0103 0.0086 43 0.0102 0.0085 44 0.0100 0.0084 45 0.0096 0.0081 46 0.0096 0.0081 47 0.0095 0.0077 48 0.0094 0.0077 49 0.0092 0.0075 50 0.0090 0.0071 51 0.0086 0.0068 52 0.0084 0.0068 53 0.0078 0.0066 54 0.0073 0.0065 55 0.0061 0.0065 56 0.0058 0.0065 57 0.0055 0.0059 58 0.0054 0.0056 59 0.0036 0.0055 60 0.0019 0.0055 61 0.0013 0.0051 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 13 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 14 Duration Flows The Facility PASSED Flow(cfs) Predev Mit Percentage Pass/Fail 0.0069 17554 9903 56 Pass 0.0072 16164 7875 48 Pass 0.0075 14966 6483 43 Pass 0.0078 13851 5388 38 Pass 0.0080 12814 4601 35 Pass 0.0083 11807 4053 34 Pass 0.0086 10898 3702 33 Pass 0.0089 10119 3439 33 Pass 0.0091 9383 3157 33 Pass 0.0094 8729 2911 33 Pass 0.0097 8145 2661 32 Pass 0.0099 7593 2430 32 Pass 0.0102 7073 2263 31 Pass 0.0105 6596 2074 31 Pass 0.0108 6149 1939 31 Pass 0.0110 5781 1834 31 Pass 0.0113 5437 1741 32 Pass 0.0116 5099 1646 32 Pass 0.0119 4810 1570 32 Pass 0.0121 4530 1472 32 Pass 0.0124 4252 1421 33 Pass 0.0127 4019 1374 34 Pass 0.0129 3790 1338 35 Pass 0.0132 3546 1296 36 Pass 0.0135 3339 1241 37 Pass 0.0138 3138 1197 38 Pass 0.0140 2954 1154 39 Pass 0.0143 2787 1111 39 Pass 0.0146 2599 1073 41 Pass 0.0149 2449 1032 42 Pass 0.0151 2304 986 42 Pass 0.0154 2162 943 43 Pass 0.0157 2029 898 44 Pass 0.0160 1898 861 45 Pass 0.0162 1790 821 45 Pass 0.0165 1690 768 45 Pass 0.0168 1584 725 45 Pass 0.0170 1483 689 46 Pass 0.0173 1382 659 47 Pass 0.0176 1292 637 49 Pass 0.0179 1220 609 49 Pass 0.0181 1155 585 50 Pass 0.0184 1098 561 51 Pass 0.0187 1048 519 49 Pass 0.0190 997 489 49 Pass 0.0192 930 462 49 Pass 0.0195 883 439 49 Pass 0.0198 838 416 49 Pass 0.0200 789 394 49 Pass 0.0203 743 374 50 Pass 0.0206 713 358 50 Pass 0.0209 670 343 51 Pass 0.0211 630 321 50 Pass 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 15 0.0214 596 298 50 Pass 0.0217 567 281 49 Pass 0.0220 539 256 47 Pass 0.0222 497 228 45 Pass 0.0225 473 214 45 Pass 0.0228 436 202 46 Pass 0.0231 399 190 47 Pass 0.0233 367 178 48 Pass 0.0236 348 168 48 Pass 0.0239 323 153 47 Pass 0.0241 296 143 48 Pass 0.0244 273 135 49 Pass 0.0247 256 123 48 Pass 0.0250 235 118 50 Pass 0.0252 217 111 51 Pass 0.0255 195 104 53 Pass 0.0258 180 99 55 Pass 0.0261 158 93 58 Pass 0.0263 145 87 60 Pass 0.0266 129 84 65 Pass 0.0269 119 79 66 Pass 0.0271 109 75 68 Pass 0.0274 97 70 72 Pass 0.0277 91 63 69 Pass 0.0280 82 53 64 Pass 0.0282 76 48 63 Pass 0.0285 69 46 66 Pass 0.0288 61 44 72 Pass 0.0291 54 42 77 Pass 0.0293 48 39 81 Pass 0.0296 41 37 90 Pass 0.0299 38 35 92 Pass 0.0302 33 31 93 Pass 0.0304 27 23 85 Pass 0.0307 22 20 90 Pass 0.0310 21 16 76 Pass 0.0312 20 7 35 Pass 0.0315 19 2 10 Pass 0.0318 17 2 11 Pass 0.0321 14 2 14 Pass 0.0323 12 2 16 Pass 0.0326 8 2 25 Pass 0.0329 4 2 50 Pass 0.0332 3 2 66 Pass 0.0334 3 2 66 Pass 0.0337 3 2 66 Pass 0.0340 3 2 66 Pass 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 16 Water Quality Water Quality BMP Flow and Volume for POC #1 On-line facility volume: 0.0409 acre-feet On-line facility target flow: 0.046 cfs. Adjusted for 15 min: 0.046 cfs. Off-line facility target flow: 0.0257 cfs. Adjusted for 15 min: 0.0257 cfs. 2019013-Twin Lakes Coffee 10/6/2020 4:40:30 PM Page 17 LID Report 2019013-Twin Lakes Coffee 10/6/2020 4:40:38 PM Page 18 POC 2 POC #2 was not reported because POC must exist in both scenarios and both scenarios must have been run. 2019013-Twin Lakes Coffee 10/6/2020 4:40:38 PM Page 19 Model Default Modifications Total of 0 changes have been made. PERLND Changes No PERLND changes have been made. IMPLND Changes No IMPLND changes have been made. 2019013-Twin Lakes Coffee 10/6/2020 4:40:38 PM Page 20 Appendix Predeveloped Schematic 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 21 Mitigated Schematic 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 22 Predeveloped UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 2019013-Twin Lakes Coffee.wdm MESSU 25 Pre2019013-Twin Lakes Coffee.MES 27 Pre2019013-Twin Lakes Coffee.L61 28 Pre2019013-Twin Lakes Coffee.L62 30 POC2019013-Twin Lakes Coffee1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 10 COPY 501 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Basin 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 10 C, Forest, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 10 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 10 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 23 PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 10 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 10 0 4.5 0.08 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 10 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 10 0.2 0.5 0.35 6 0.5 0.7 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 10 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** END IWAT-PARM1 IWAT-PARM2 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS END IWAT-STATE1 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 24 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** Basin 1*** PERLND 10 0.472 COPY 501 12 PERLND 10 0.472 COPY 501 13 ******Routing****** END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** END ACTIVITY PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1 IMPLND 1 999 EXTNL PREC 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 25 WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** COPY 501 OUTPUT MEAN 1 1 48.4 WDM 501 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 END MASS-LINK END RUN 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 26 Mitigated UCI File RUN GLOBAL WWHM4 model simulation START 1948 10 01 END 2009 09 30 RUN INTERP OUTPUT LEVEL 3 0 RESUME 0 RUN 1 UNIT SYSTEM 1 END GLOBAL FILES <File> <Un#> <-----------File Name------------------------------>*** <-ID-> *** WDM 26 2019013-Twin Lakes Coffee.wdm MESSU 25 Mit2019013-Twin Lakes Coffee.MES 27 Mit2019013-Twin Lakes Coffee.L61 28 Mit2019013-Twin Lakes Coffee.L62 30 POC2019013-Twin Lakes Coffee1.dat END FILES OPN SEQUENCE INGRP INDELT 00:15 PERLND 16 IMPLND 1 IMPLND 14 RCHRES 1 COPY 1 COPY 501 COPY 601 DISPLY 1 END INGRP END OPN SEQUENCE DISPLY DISPLY-INFO1 # - #<----------Title----------->***TRAN PIVL DIG1 FIL1 PYR DIG2 FIL2 YRND 1 Trapezoidal Pond 1 MAX 1 2 30 9 END DISPLY-INFO1 END DISPLY COPY TIMESERIES # - # NPT NMN *** 1 1 1 501 1 1 601 1 1 END TIMESERIES END COPY GENER OPCODE # # OPCD *** END OPCODE PARM # # K *** END PARM END GENER PERLND GEN-INFO <PLS ><-------Name------->NBLKS Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 16 C, Lawn, Flat 1 1 1 1 27 0 END GEN-INFO *** Section PWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC *** 16 0 0 1 0 0 0 0 0 0 0 0 0 END ACTIVITY 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 27 PRINT-INFO <PLS > ***************** Print-flags ***************************** PIVL PYR # - # ATMP SNOW PWAT SED PST PWG PQAL MSTL PEST NITR PHOS TRAC ********* 16 0 0 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO PWAT-PARM1 <PLS > PWATER variable monthly parameter value flags *** # - # CSNO RTOP UZFG VCS VUZ VNN VIFW VIRC VLE INFC HWT *** 16 0 0 0 0 0 0 0 0 0 0 0 END PWAT-PARM1 PWAT-PARM2 <PLS > PWATER input info: Part 2 *** # - # ***FOREST LZSN INFILT LSUR SLSUR KVARY AGWRC 16 0 4.5 0.03 400 0.05 0.5 0.996 END PWAT-PARM2 PWAT-PARM3 <PLS > PWATER input info: Part 3 *** # - # ***PETMAX PETMIN INFEXP INFILD DEEPFR BASETP AGWETP 16 0 0 2 2 0 0 0 END PWAT-PARM3 PWAT-PARM4 <PLS > PWATER input info: Part 4 *** # - # CEPSC UZSN NSUR INTFW IRC LZETP *** 16 0.1 0.25 0.25 6 0.5 0.25 END PWAT-PARM4 PWAT-STATE1 <PLS > *** Initial conditions at start of simulation ran from 1990 to end of 1992 (pat 1-11-95) RUN 21 *** # - # *** CEPS SURS UZS IFWS LZS AGWS GWVS 16 0 0 0 0 2.5 1 0 END PWAT-STATE1 END PERLND IMPLND GEN-INFO <PLS ><-------Name-------> Unit-systems Printer *** # - # User t-series Engl Metr *** in out *** 1 ROADS/FLAT 1 1 1 27 0 14 POND 1 1 1 27 0 END GEN-INFO *** Section IWATER*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # ATMP SNOW IWAT SLD IWG IQAL *** 1 0 0 1 0 0 0 14 0 0 1 0 0 0 END ACTIVITY PRINT-INFO <ILS > ******** Print-flags ******** PIVL PYR # - # ATMP SNOW IWAT SLD IWG IQAL ********* 1 0 0 4 0 0 0 1 9 14 0 0 4 0 0 0 1 9 END PRINT-INFO IWAT-PARM1 <PLS > IWATER variable monthly parameter value flags *** # - # CSNO RTOP VRS VNN RTLI *** 1 0 0 0 0 0 14 0 0 0 0 0 END IWAT-PARM1 IWAT-PARM2 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 28 <PLS > IWATER input info: Part 2 *** # - # *** LSUR SLSUR NSUR RETSC 1 400 0.01 0.1 0.1 14 400 0.01 0.1 0.1 END IWAT-PARM2 IWAT-PARM3 <PLS > IWATER input info: Part 3 *** # - # ***PETMAX PETMIN 1 0 0 14 0 0 END IWAT-PARM3 IWAT-STATE1 <PLS > *** Initial conditions at start of simulation # - # *** RETS SURS 1 0 0 14 0 0 END IWAT-STATE1 END IMPLND SCHEMATIC <-Source-> <--Area--> <-Target-> MBLK *** <Name> # <-factor-> <Name> # Tbl# *** To Stormwater Pond*** PERLND 16 0.106 RCHRES 1 2 PERLND 16 0.106 RCHRES 1 3 IMPLND 1 0.2053 RCHRES 1 5 IMPLND 14 0.0773 RCHRES 1 5 Bypass*** PERLND 16 0.083264 COPY 501 12 PERLND 16 0.083264 COPY 601 12 PERLND 16 0.083264 COPY 501 13 PERLND 16 0.083264 COPY 601 13 ******Routing****** PERLND 16 0.10602 COPY 1 12 IMPLND 1 0.2053 COPY 1 15 IMPLND 14 0.0773 COPY 1 15 PERLND 16 0.10602 COPY 1 13 RCHRES 1 1 COPY 501 16 END SCHEMATIC NETWORK <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** COPY 501 OUTPUT MEAN 1 1 48.4 DISPLY 1 INPUT TIMSER 1 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # #<-factor->strg <Name> # # <Name> # # *** END NETWORK RCHRES GEN-INFO RCHRES Name Nexits Unit Systems Printer *** # - #<------------------><---> User T-series Engl Metr LKFG *** in out *** 1 Trapezoidal Pond-005 1 1 1 1 28 0 1 END GEN-INFO *** Section RCHRES*** ACTIVITY <PLS > ************* Active Sections ***************************** # - # HYFG ADFG CNFG HTFG SDFG GQFG OXFG NUFG PKFG PHFG *** 1 1 0 0 0 0 0 0 0 0 0 END ACTIVITY 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 29 PRINT-INFO <PLS > ***************** Print-flags ******************* PIVL PYR # - # HYDR ADCA CONS HEAT SED GQL OXRX NUTR PLNK PHCB PIVL PYR ********* 1 4 0 0 0 0 0 0 0 0 0 1 9 END PRINT-INFO HYDR-PARM1 RCHRES Flags for each HYDR Section *** # - # VC A1 A2 A3 ODFVFG for each *** ODGTFG for each FUNCT for each FG FG FG FG possible exit *** possible exit possible exit * * * * * * * * * * * * * * *** 1 0 1 0 0 4 0 0 0 0 0 0 0 0 0 2 2 2 2 2 END HYDR-PARM1 HYDR-PARM2 # - # FTABNO LEN DELTH STCOR KS DB50 *** <------><--------><--------><--------><--------><--------><--------> *** 1 1 0.02 0.0 0.0 0.5 0.0 END HYDR-PARM2 HYDR-INIT RCHRES Initial conditions for each HYDR section *** # - # *** VOL Initial value of COLIND Initial value of OUTDGT *** ac-ft for each possible exit for each possible exit <------><--------> <---><---><---><---><---> *** <---><---><---><---><---> 1 0 4.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 END HYDR-INIT END RCHRES SPEC-ACTIONS END SPEC-ACTIONS FTABLES FTABLE 1 91 4 Depth Area Volume Outflow1 Velocity Travel Time*** (ft) (acres) (acre-ft) (cfs) (ft/sec) (Minutes)*** 0.000000 0.003903 0.000000 0.000000 0.066667 0.004705 0.000287 0.000684 0.133333 0.005515 0.000628 0.000968 0.200000 0.006332 0.001023 0.001185 0.266667 0.007157 0.001472 0.001368 0.333333 0.007989 0.001977 0.001530 0.400000 0.008828 0.002538 0.001676 0.466667 0.009675 0.003154 0.001810 0.533333 0.010529 0.003828 0.001935 0.600000 0.011390 0.004558 0.002053 0.666667 0.012259 0.005347 0.002164 0.733333 0.013135 0.006193 0.002269 0.800000 0.014018 0.007098 0.002370 0.866667 0.014909 0.008063 0.002467 0.933333 0.015807 0.009087 0.002560 1.000000 0.016713 0.010170 0.002650 1.066667 0.017625 0.011315 0.002737 1.133333 0.018545 0.012521 0.002821 1.200000 0.019473 0.013788 0.002903 1.266667 0.020408 0.015117 0.002983 1.333333 0.021350 0.016509 0.003060 1.400000 0.022299 0.017964 0.003136 1.466667 0.023256 0.019483 0.003209 1.533333 0.024220 0.021065 0.003282 1.600000 0.025192 0.022712 0.003352 1.666667 0.026171 0.024425 0.003421 1.733333 0.027157 0.026202 0.003489 1.800000 0.028151 0.028046 0.003555 1.866667 0.029152 0.029956 0.003621 1.933333 0.030160 0.031933 0.003685 2.000000 0.031175 0.033977 0.003748 2.066667 0.032198 0.036090 0.003810 2.133333 0.033229 0.038271 0.003871 2.200000 0.034266 0.040521 0.003931 2.266667 0.035311 0.042840 0.003990 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 30 2.333333 0.036364 0.045229 0.004048 2.400000 0.037423 0.047689 0.004105 2.466667 0.038490 0.050219 0.004162 2.533333 0.039565 0.052821 0.004218 2.600000 0.040646 0.055495 0.004273 2.666667 0.041736 0.058241 0.004328 2.733333 0.042832 0.061060 0.004381 2.800000 0.043936 0.063952 0.004434 2.866667 0.045047 0.066918 0.004487 2.933333 0.046165 0.069958 0.004539 3.000000 0.047291 0.073073 0.004590 3.066667 0.048424 0.076264 0.004641 3.133333 0.049565 0.079530 0.004691 3.200000 0.050713 0.082873 0.004741 3.266667 0.051868 0.086292 0.004790 3.333333 0.053030 0.089789 0.004838 3.400000 0.054200 0.093363 0.004887 3.466667 0.055377 0.097016 0.004934 3.533333 0.056562 0.100747 0.004981 3.600000 0.057754 0.104558 0.005028 3.666667 0.058953 0.108448 0.005075 3.733333 0.060160 0.112418 0.005120 3.800000 0.061374 0.116469 0.005166 3.866667 0.062595 0.120602 0.005211 3.933333 0.063824 0.124816 0.011526 4.000000 0.065060 0.129112 0.016161 4.066667 0.066303 0.133490 0.019365 4.133333 0.067554 0.137952 0.021978 4.200000 0.068812 0.142498 0.024243 4.266667 0.070077 0.147128 0.026271 4.333333 0.071350 0.151842 0.028125 4.400000 0.072630 0.156641 0.029844 4.466667 0.073917 0.161526 0.031455 4.533333 0.075212 0.166497 0.032975 4.600000 0.076514 0.171555 0.034419 4.666667 0.077824 0.176699 0.218031 4.733333 0.079140 0.181931 0.546780 4.800000 0.080465 0.187251 0.946065 4.866667 0.081796 0.192660 1.357694 4.933333 0.083135 0.198158 1.724267 5.000000 0.084481 0.203745 2.001982 5.066667 0.085835 0.209422 2.181388 5.133333 0.087196 0.215190 2.344311 5.200000 0.088564 0.221049 2.484895 5.266667 0.089939 0.226999 2.617895 5.333333 0.091322 0.233041 2.744421 5.400000 0.092713 0.239175 2.865337 5.466667 0.094110 0.245403 2.981331 5.533333 0.095515 0.251723 3.092959 5.600000 0.096927 0.258138 3.200682 5.666667 0.098347 0.264647 3.304882 5.733333 0.099774 0.271251 3.405886 5.800000 0.101208 0.277951 3.503970 5.866667 0.102650 0.284746 3.599375 5.933333 0.104099 0.291638 3.692309 6.000000 0.105556 0.298626 3.782955 END FTABLE 1 END FTABLES EXT SOURCES <-Volume-> <Member> SsysSgap<--Mult-->Tran <-Target vols> <-Grp> <-Member-> *** <Name> # <Name> # tem strg<-factor->strg <Name> # # <Name> # # *** WDM 2 PREC ENGL 1 PERLND 1 999 EXTNL PREC WDM 2 PREC ENGL 1 IMPLND 1 999 EXTNL PREC WDM 1 EVAP ENGL 0.76 PERLND 1 999 EXTNL PETINP WDM 1 EVAP ENGL 0.76 IMPLND 1 999 EXTNL PETINP END EXT SOURCES EXT TARGETS 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 31 <-Volume-> <-Grp> <-Member-><--Mult-->Tran <-Volume-> <Member> Tsys Tgap Amd *** <Name> # <Name> # #<-factor->strg <Name> # <Name> tem strg strg*** RCHRES 1 HYDR RO 1 1 1 WDM 1000 FLOW ENGL REPL RCHRES 1 HYDR STAGE 1 1 1 WDM 1001 STAG ENGL REPL COPY 1 OUTPUT MEAN 1 1 48.4 WDM 701 FLOW ENGL REPL COPY 501 OUTPUT MEAN 1 1 48.4 WDM 801 FLOW ENGL REPL COPY 601 OUTPUT MEAN 1 1 48.4 WDM 901 FLOW ENGL REPL END EXT TARGETS MASS-LINK <Volume> <-Grp> <-Member-><--Mult--> <Target> <-Grp> <-Member->*** <Name> <Name> # #<-factor-> <Name> <Name> # #*** MASS-LINK 2 PERLND PWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 2 MASS-LINK 3 PERLND PWATER IFWO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 3 MASS-LINK 5 IMPLND IWATER SURO 0.083333 RCHRES INFLOW IVOL END MASS-LINK 5 MASS-LINK 12 PERLND PWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 12 MASS-LINK 13 PERLND PWATER IFWO 0.083333 COPY INPUT MEAN END MASS-LINK 13 MASS-LINK 15 IMPLND IWATER SURO 0.083333 COPY INPUT MEAN END MASS-LINK 15 MASS-LINK 16 RCHRES ROFLOW COPY INPUT MEAN END MASS-LINK 16 END MASS-LINK END RUN 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 32 Predeveloped HSPF Message File 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 33 Mitigated HSPF Message File 2019013-Twin Lakes Coffee 10/6/2020 4:40:39 PM Page 34 Disclaimer Legal Notice This program and accompanying documentation are provided 'as-is' without warranty of any kind. The entire risk regarding the performance and results of this program is assumed by End User. Clear Creek Solutions Inc. and the governmental licensee or sublicensees disclaim all warranties, either expressed or implied, including but not limited to implied warranties of program and accompanying documentation. In no event shall Clear Creek Solutions Inc. be liable for any damages whatsoever (including without limitation to damages for loss of business profits, loss of business information, business interruption, and the like) arising out of the use of, or inability to use this program even if Clear Creek Solutions Inc. or their authorized representatives have been advised of the possibility of such damages. Software Copyright © by : Clear Creek Solutions, Inc. 2005-2020; All Rights Reserved. Clear Creek Solutions, Inc. 6200 Capitol Blvd. Ste F Olympia, WA. 98501 Toll Free 1(866)943-0304 Local (360)943-0304 www.clearcreeksolutions.com APPENDIX D: OFF-SITE ANALYSIS KingKing County iMapDate: 9/28/2020 Notes:The information included on this map has been compiled by King County staff from a variety of sources and is subject to changewithout notice. King County makes no representations or warranties, express or implied, as to accuracy, completeness, timeliness,or rights to the use of such information. This document is not intended for use as a survey product. King County shall not be liablefor any general, special, indirect, incidental, or consequential damages including, but not limited to, lost revenues or lost profitsresulting from the use or misuse of the information contained on this map. Any sale of this map or information on this map isprohibited except by written permission of King County.±JUMP START ESPRESSO DOWNSTREAM MAP1/4MILEDOWNSTREAMPROJECT SITE1321039067PRIMARYOUTFALLEXG PUBLICCONVEYANCESYSTEMSTREAM APPENDIX E: OTHER SPECIAL REPORTS APPENDIX F: OPERATION & MAINTENANCE MANUAL STORMWATER POLLUTION PREVENTION MAINTENANCE and OPERATION SCHEDULE for Jump Start Espresso Site Address: The project is located at 3450 SW 320th Street, Federal Way, WA in Section 13, Township 21 North, Range 3 East, W.M. The development will occur on tax parcel number 1321039067. Introduction: This stormwater site plan has been prepared to address the City of Federal Way’s site development and storm drainage requirements for the proposed Jump Start Espresso project. Approximately 0.44 acres of the site will be disturbed for construction. The subject site will be developed by constructing a new building and access. According to the City of Federal Way’s standards for stormwater management, the city requires stormwater quantity and quality control for all proposed developments where they meet the thresholds in the City’s Surface Water Design Manual. This project will provide flow control by providing a detention pond to match the 2 and 10- year historic peak flow rates and durations for the range of historic flow rates from 50% of the 2-year to the 50-year peak flow rate. Plan Goal: The specific purpose for the stormwater facility is to minimize pollution that is typically associated with modern development. This includes, in general, pollution from motor vehicles and pollution generated from erosion. Attached to this narrative is a maintenance manual, which offers guidelines to the owner for stormwater facility maintenance. Prevention BMP’s: Any catch basins shall have stenciled on them “DUMP NO WASTE – DRAINS TO STREAM.” The owner shall be responsible for sweeping the lot, installing storm drainage stenciling and providing spill control procedures. In case of spill, call the Washington State Department of Ecology at (425) 649-7000. The catch basins must be visually inspected for accumulation of debris and silt and will be maintained as required by this operation and maintenance manual and attachments. Maintenance Standards for Drainage Facilities: No. 1 - Detention Ponds No. 4 - Control Structure/Flow Restrictor No. 5 - Catch Basins and Manholes No. 6 - Conveyance Pipes and Ditches No. 11 - Grounds (Landscaping) No. 31 – Bioretention BMP Treatment BMP’s: The project will install a BioPod for runoff treatment. Inspection/Maintenance: Regular inspections of the stormwater facilities should be carried out twice per year, in the spring and fall. The responsible party should keep records of these inspections available for review by the City. Additional inspections may be required after severe seasonal storms. Routine maintenance of the site will include mowing, care of landscaping, and the removal of trash and debris from the proposed detention facilities. The driveways should be kept clean and in repair. Events such as major storms or heavy winds will require immediate inspections for damages. Be careful to avoid introducing landscape fertilizer to receiving waters or groundwater. Catch basins shall be cleaned when sump contains four inches or more of sediment or debris. Plan and/or Information Updates: The City of Kent Storm Drainage Utility section is to review and approve any changes to this Operation and Maintenance Manual prior to changes in its implementation. Additionally, any changes in ownership or person of responsibility are to be reported to the City Storm Drainage Utility section. Person of Responsibility: Design Engineer: Twin Lakes Plaza LLC AP Consulting Engineers PLLC Mr. Court Pixton Adam E. Paul, PE 33919 9th Avenue South, Suite 105 PO Box 162 Federal Way, WA, 98003 Auburn, WA 98071 INSPECTION/MAINTENANCE CHECKLIST STRUCTURE RESULTS/ MAINTENANCE DATE NOTES All Catch Basins Inspection results Maintenance Done Detention Pond Inspection results Maintenance Done Conveyance System Inspection Results Maintenance Done Control Structure/Flow Restrictor Inspection Results Maintenance Done Grounds (Landscaping) Inspection Results Maintenance Done Bioretention BMP Inspection Results Maintenance Done $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± '(7(17,21321'6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFH,V1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFH,V3HUIRUPHG 6LWH 7UDVKDQGGHEULV $Q\WUDVKDQGGHEULVZKLFKH[FHHGFXELFIRRW SHUVTXDUHIHHWWKLVLVDERXWHTXDOWRWKH DPRXQWRIWUDVKLWZRXOGWDNHWRILOOXSRQH VWDQGDUGVL]HRIILFHJDUEDJHFDQ,QJHQHUDO WKHUHVKRXOGEHQRYLVXDOHYLGHQFHRIGXPSLQJ 7UDVKDQGGHEULVFOHDUHGIURPVLWH 1R[LRXVZHHGV $Q\QR[LRXVRUQXLVDQFHYHJHWDWLRQZKLFKPD\ FRQVWLWXWHDKD]DUGWR&RXQW\SHUVRQQHORUWKH SXEOLF 1R[LRXVDQGQXLVDQFHYHJHWDWLRQ UHPRYHGDFFRUGLQJWRDSSOLFDEOH UHJXODWLRQV1RGDQJHURIQR[LRXV YHJHWDWLRQZKHUH&RXQW\SHUVRQQHO RUWKHSXEOLFPLJKWQRUPDOO\EH &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP *UDVVJURXQGFRYHU *UDVVRUJURXQGFRYHU H[FHHGVLQFKHVLQ KHLJKW *UDVVRUJURXQGFRYHUPRZHGWRD KHLJKWQRJUHDWHUWKDQLQFKHV 7RSRU6LGH6ORSHV RI'DP%HUPRU (PEDQNPHQW 5RGHQWKROHV $Q\HYLGHQFHRIURGHQWKROHVLIIDFLOLW\LVDFWLQJ DVDGDPRUEHUPRUDQ\HYLGHQFHRIZDWHU SLSLQJWKURXJKGDPRUEHUPYLDURGHQWKROHV 5RGHQWVUHPRYHGRUGHVWUR\HGDQG GDPRUEHUPUHSDLUHG 7UHHJURZWK 7UHHJURZWKWKUHDWHQVLQWHJULW\RIVORSHVGRHV QRWDOORZPDLQWHQDQFHDFFHVVRULQWHUIHUHVZLWK PDLQWHQDQFHDFWLYLW\,IWUHHVDUHQRWDWKUHDWRU QRWLQWHUIHULQJZLWKDFFHVVRUPDLQWHQDQFHWKH\ GRQRWQHHGWREHUHPRYHG 7UHHV GRQRWKLQGHU IDFLOLW\ SHUIRUPDQFHRUPDLQWHQDQFH DFWLYLWLHV (URVLRQ (URGHGGDPDJHRYHULQFKHVGHHSZKHUHFDXVH RIGDPDJHLVVWLOOSUHVHQWRUZKHUHWKHUHLV SRWHQWLDOIRUFRQWLQXHGHURVLRQ$Q\HURVLRQ REVHUYHGRQDFRPSDFWHGVORSH 6ORSHVVWDELOL]HGXVLQJDSSURSULDWH HURVLRQFRQWUROPHDVXUHV,IHURVLRQ LVRFFXUULQJRQFRPSDFWHGVORSHD OLFHQVHGFLYLOHQJLQHHUVKRXOGEH FRQVXOWHGWRUHVROYHVRXUFHRI HURVLRQ 6HWWOHPHQW $Q\SDUWRIDGDPEHUPRUHPEDQNPHQWWKDW KDVVHWWOHGLQFKHVORZHUWKDQWKHGHVLJQ HOHYDWLRQ 7RSRUVLGHVORSHUHVWRUHGWRGHVLJQ GLPHQVLRQV,IVHWWOHPHQWLV VLJQLILFDQWDOLFHQVHGFLYLOHQJLQHHU VKRXOGEHFRQVXOWHGWRGHWHUPLQH WKHFDXVH RIWKHVHWWOHPHQW 6WRUDJH$UHD 6HGLPHQW DFFXPXODWLRQ $FFXPXODWHGVHGLPHQWWKDWH[FHHGVRIWKH GHVLJQHGSRQGGHSWK 6HGLPHQWFOHDQHGRXWWRGHVLJQHG SRQGVKDSHDQGGHSWKSRQG UHVHHGHGLIQHFHVVDU\WRFRQWURO HURVLRQ /LQHUGDPDJHG ,I$SSOLFDEOH /LQHULVYLVLEOHRUSRQGGRHVQRWKROGZDWHUDV GHVLJQHG /LQHUUHSDLUHGRUUHSODFHG ,QOHW2XWOHW3LSH 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWILOOLQJRUPRUHRIWKHSLSH ,QOHWRXWOHWSLSHVFOHDURIVHGLPHQW 7UDVKDQGGHEULV 7UDVKDQGGHEULVDFFXPXODWHGLQLQOHWRXWOHW SLSHVLQFOXGHVIORDWDEOHVDQGQRQIORDWDEOHV 1RWUDVKRUGHEULVLQSLSHV 'DPDJHG &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLO HQWHULQJ DWWKHMRLQWV RIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFK ZLGHDW WKHMRLQWRIWKHLQOHWRXWOHWSLSH (PHUJHQF\ 2YHUIORZ6SLOOZD\ 7UHHJURZWK 7UHHJURZWKLPSHGHVIORZRUWKUHDWHQVVWDELOLW\RI VSLOOZD\ 7UHHVUHPRYHG 5RFNPLVVLQJ 2QO\RQHOD\HURIURFNH[LVWVDERYHQDWLYHVRLOLQ DUHDILYHVTXDUHIHHWRUODUJHURUDQ\H[SRVXUHRI QDWLYHVRLORQWKHVSLOOZD\ 6SLOOZD\ UHVWRUHGWRGHVLJQ VWDQGDUGV 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &21752/ 6758&785()/2: 5(675,&725 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 6WUXFWXUH 7UDVKDQGGHEULV 7UDVKRUGHEULVRIPRUHWKDQòFXELFIRRWZKLFK LVORFDWHGLPPHGLDWHO\LQIURQWRIWKHVWUXFWXUH RSHQLQJRULVEORFNLQJFDSDFLW\RIWKHVWUXFWXUH E\PRUHWKDQ 1R7UDVKRUGHEULVEORFNLQJRU SRWHQWLDOO\EORFNLQJHQWUDQFHWR VWUXFWXUH 7UDVKRUGHEULVLQWKHVWUXFWXUHWKDWH[FHHGV WKHGHSWKIURPWKHERWWRPRIEDVLQWRLQYHUWWKH ORZHVWSLSHLQWRRURXWRIWKHEDVLQ 1RWUDVKRUGHEULVLQWKHVWUXFWXUH 'HSRVLWVRIJDUEDJHH[FHHGLQJFXELFIRRWLQ YROXPH 1RFRQGLWLRQSUHVHQWZKLFKZRXOG DWWUDFWRUVXSSRUWWKHEUHHGLQJRI LQVHFWVRUURGHQWV 6HGLPHQW 6HGLPHQWH[FHHGVRIWKHGHSWKIURPWKH ERWWRPRIWKHVWUXFWXUHWRWKHLQYHUWRIWKHORZHVW SLSHLQWRRURXWRIWKHVWUXFWXUHRUWKHERWWRPRI WKH)5237VHFWLRQRULVZLWKLQLQFKHVRIWKH LQYHUWRIWKHORZHVWSLSHLQWRRURXWRIWKH VWUXFWXUHRUWKHERWWRPRIWKH)5237VHFWLRQ 6XPSRIVWUXFWXUHFRQWDLQVQR VHGLPHQW 'DPDJHWRIUDPH DQGRUWRSVODE &RUQHURIIUDPHH[WHQGVPRUHWKDQôLQFKSDVW FXUEIDFHLQWRWKHVWUHHW,IDSSOLFDEOH )UDPHLVHYHQZLWKFXUE 7RSVODEKDVKROHVODUJHUWKDQVTXDUHLQFKHV RUFUDFNVZLGHUWKDQóLQFK 7RSVODELVIUHH RIKROHVDQGFUDFNV )UDPHQRWVLWWLQJIOXVKRQWRSVODELH VHSDUDWLRQRIPRUHWKDQôLQFKRIWKHIUDPHIURP WKHWRSVODE )UDPHLVVLWWLQJIOXVKRQWRSVODE &UDFNVLQZDOOVRU ERWWRP &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIHHW DQ\HYLGHQFH RIVRLOSDUWLFOHVHQWHULQJVWUXFWXUH WKURXJKFUDFNVRUPDLQWHQDQFHSHUVRQMXGJHV WKDWVWUXFWXUHLVXQVRXQG 6WUXFWXUHLVVHDOHGDQGVWUXFWXUDOO\ VRXQG &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIRRW DWWKHMRLQWRIDQ\LQOHWRXWOHWSLSHRUDQ\ HYLGHQFHRIVRLOSDUWLFOHVHQWHULQJVWUXFWXUH WKURXJKFUDFNV 1RFUDFNVPRUHWKDQLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSH 6HWWOHPHQW PLVDOLJQPHQW 6WUXFWXUHKDVVHWWOHGPRUHWKDQLQFKRUKDV URWDWHGPRUHWKDQLQFKHVRXWRIDOLJQPHQW %DVLQUHSODFHGRUUHSDLUHGWRGHVLJQ VWDQGDUGV 'DPDJHGSLSHMRLQWV &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ WKHVWUXFWXUHDWWKHMRLQWRIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSHV &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP /DGGHUUXQJVPLVVLQJ RUXQVDIH /DGGHULVXQVDIHGXHWRPLVVLQJUXQJV PLVDOLJQPHQWUXVWFUDFNVRUVKDUSHGJHV /DGGHUPHHWVGHVLJQVWDQGDUGVDQG DOORZVPDLQWHQDQFHSHUVRQVDIH DFFHVV )52376HFWLRQ 'DPDJH 7VHFWLRQLVQRWVHFXUHO\DWWDFKHGWRVWUXFWXUH ZDOODQGRXWOHWSLSHVWUXFWXUHVKRXOGVXSSRUWDW OHDVWOEVRIXSRUGRZQSUHVVXUH 7VHFWLRQVHFXUHO\DWWDFKHGWRZDOO DQGRXWOHWSLSH 6WUXFWXUH LVQRWLQXSULJKWSRVLWLRQDOORZXSWR IURPSOXPE 6WUXFWXUHLQFRUUHFWSRVLWLRQ &RQQHFWLRQVWRRXWOHWSLSHDUHQRWZDWHUWLJKWRU VKRZVLJQVRIGHWHULRUDWHGJURXW &RQQHFWLRQVWRRXWOHWSLSHDUHZDWHU WLJKWVWUXFWXUHUHSDLUHGRUUHSODFHG DQGZRUNVDVGHVLJQHG $Q\KROHV²RWKHUWKDQGHVLJQHGKROHV²LQWKH VWUXFWXUH 6WUXFWXUHKDVQRKROHVRWKHUWKDQ GHVLJQHGKROHV 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &21752/ 6758&785()/2: 5(675,&725 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG &OHDQRXW*DWH 'DPDJHGRUPLVVLQJ &OHDQRXWJDWHLVPLVVLQJ 5HSODFHFOHDQRXWJDWH &OHDQRXWJDWHLVQRWZDWHUWLJKW *DWHLVZDWHUWLJKWDQGZRUNVDV GHVLJQHG *DWHFDQQRWEHPRYHGXSDQGGRZQE\RQH PDLQWHQDQFHSHUVRQ *DWHPRYHVXSDQGGRZQHDVLO\DQG LVZDWHUWLJKW &KDLQURGOHDGLQJWRJDWHLVPLVVLQJRUGDPDJHG &KDLQLVLQSODFHDQGZRUNVDV GHVLJQHG 2ULILFH3ODWH 'DPDJHGRUPLVVLQJ &RQWUROGHYLFHLVQRWZRUNLQJSURSHUO\GXHWR PLVVLQJRXWRISODFHRUEHQWRULILFHSODWH 3ODWHLVLQSODFHDQGZRUNVDV GHVLJQHG 2EVWUXFWLRQV $Q\WUDVKGHEULVVHGLPHQW RUYHJHWDWLRQ EORFNLQJWKHSODWH 3ODWHLVIUHHRIDOOREVWUXFWLRQVDQG ZRUNVDVGHVLJQHG 2YHUIORZ3LSH 2EVWUXFWLRQV $Q\WUDVKRUGHEULVEORFNLQJRUKDYLQJWKH SRWHQWLDORIEORFNLQJWKHRYHUIORZSLSH 3LSHLVIUHHRI DOOREVWUXFWLRQVDQG ZRUNVDVGHVLJQHG 'HIRUPHGRU GDPDJHGOLS /LSRIRYHUIORZSLSHLVEHQWRUGHIRUPHG 2YHUIORZSLSHGRHVQRWDOORZ RYHUIORZDWDQHOHYDWLRQORZHUWKDQ GHVLJQ ,QOHW2XWOHW3LSH 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWILOOLQJRUPRUHRIWKHSLSH ,QOHWRXWOHWSLSHVFOHDURIVHGLPHQW 7UDVKDQGGHEULV 7UDVKDQGGHEULVDFFXPXODWHGLQLQOHWRXWOHW SLSHVLQFOXGHVIORDWDEOHVDQGQRQIORDWDEOHV 1RWUDVKRUGHEULVLQSLSHV 'DPDJHG &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ DWWKHMRLQWV RIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRIWKHLQOHWRXWOHWSLSH 0HWDO*UDWHV ,I$SSOLFDEOH 8QVDIHJUDWHRSHQLQJ *UDWHZLWKRSHQLQJZLGHUWKDQ LQFK *UDWHRSHQLQJPHHWVGHVLJQ VWDQGDUGV 7UDVKDQGGHEULV 7UDVKDQGGHEULVWKDWLVEORFNLQJPRUHWKDQ RIJUDWHVXUIDFH *UDWHIUHHRIWUDVKDQGGHEULV IRRWQRWHWRJXLGHOLQHVIRUGLVSRVDO 'DPDJHGRUPLVVLQJ *UDWHPLVVLQJRUEURNHQPHPEHUVRIWKHJUDWH *UDWHLVLQSODFHDQGPHHWVGHVLJQ VWDQGDUGV 0DQKROH&RYHU/LG &RYHUOLGQRWLQSODFH &RYHUOLGLVPLVVLQJRURQO\SDUWLDOO\LQSODFH $Q\RSHQVWUXFWXUHUHTXLUHVXUJHQW PDLQWHQDQFH &RYHUOLGSURWHFWVRSHQLQJWR VWUXFWXUH /RFNLQJPHFKDQLVP 1RW:RUNLQJ 0HFKDQLVPFDQQRWEHRSHQHGE\RQH PDLQWHQDQFHSHUVRQZLWKSURSHUWRROV%ROWV FDQQRWEHVHDWHG6HOIORFNLQJFRYHUOLGGRHVQRW ZRUN 0HFKDQLVPRSHQVZLWKSURSHUWRROV &RYHUOLGGLIILFXOWWR 5HPRYH 2QHPDLQWHQDQFHSHUVRQFDQQRWUHPRYH FRYHUOLGDIWHUDSSO\LQJOEVRIOLIW &RYHUOLGFDQEHUHPRYHGDQG UHLQVWDOOHGE\RQHPDLQWHQDQFH SHUVRQ 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &$7&+%$6,16 $1'0$1+2/(6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 6WUXFWXUH 6HGLPHQW 6HGLPHQWH[FHHGVRIWKHGHSWKIURPWKH ERWWRP RIWKHFDWFKEDVLQWRWKHLQYHUWRIWKH ORZHVWSLSHLQWRRURXWRIWKHFDWFKEDVLQRULV ZLWKLQLQFKHVRIWKHLQYHUWRIWKHORZHVWSLSH LQWRRURXWRIWKHFDWFKEDVLQ 6XPSRIFDWFKEDVLQFRQWDLQVQR VHGLPHQW 7UDVKDQGGHEULV 7UDVKRUGHEULVRIPRUHWKDQòFXELFIRRWZKLFK LVORFDWHGLPPHGLDWHO\LQIURQWRIWKHFDWFKEDVLQ RSHQLQJRULVEORFNLQJFDSDFLW\RIWKHFDWFKEDVLQ E\PRUHWKDQ 1R7UDVKRUGHEULVEORFNLQJRU SRWHQWLDOO\EORFNLQJHQWUDQFHWR FDWFKEDVLQ 7UDVKRUGHEULVLQWKHFDWFKEDVLQ WKDWH[FHHGVWKHGHSWKIURPWKHERWWRPRIEDVLQWRLQYHUW WKHORZHVWSLSHLQWRRURXWRIWKHEDVLQ 1RWUDVKRUGHEULVLQWKHFDWFK EDVLQ 'HDGDQLPDOVRUYHJHWDWLRQWKDWFRXOGJHQHUDWH RGRUVWKDWFRXOGFDXVHFRPSODLQWVRUGDQJHURXV JDVHVHJPHWKDQH 1RGHDGDQLPDOVRUYHJHWDWLRQ SUHVHQWZLWKLQFDWFKEDVLQ 'HSRVLWVRIJDUEDJHH[FHHGLQJFXELFIRRWLQ YROXPH 1RFRQGLWLRQSUHVHQWZKLFKZRXOG DWWUDFWRUVXSSRUWWKHEUHHGLQJRI LQVHFWVRUURGHQWV 'DPDJHWRIUDPH DQGRUWRSVODE &RUQHURI IUDPHH[WHQGVPRUHWKDQôLQFKSDVW FXUEIDFHLQWRWKHVWUHHW,IDSSOLFDEOH )UDPHLVHYHQZLWKFXUE 7RSVODEKDVKROHVODUJHUWKDQVTXDUHLQFKHV RUFUDFNVZLGHUWKDQóLQFK 7RSVODELVIUHHRIKROHVDQGFUDFNV )UDPHQRWVLWWLQJIOXVKRQWRSVODELH VHSDUDWLRQRIPRUHWKDQôLQFKRIWKHIUDPHIURP WKHWRSVODE )UDPHLVVLWWLQJIOXVKRQWRSVODE &UDFNVLQZDOOVRU ERWWRP &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIHHW DQ\HYLGHQFHRIVRLOSDUWLFOHVHQWHULQJFDWFK EDVLQWKURXJKFUDFNVRUPDLQWHQDQFHSHUVRQ MXGJHVWKDWFDWFKEDVLQLVXQVRXQG &DWFKEDVLQLVVHDOHGDQGLV VWUXFWXUDOO\VRXQG &UDFNVZLGHUWKDQòLQFKDQGORQJHUWKDQIRRW DWWKHMRLQWRIDQ\LQOHWRXWOHWSLSHRUDQ\ HYLGHQFHRIVRLOSDUWLFOHVHQWHULQJFDWFKEDVLQ WKURXJKFUDFNV 1RFUDFNVPRUHWKDQLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSH 6HWWOHPHQW PLVDOLJQPHQW &DWFKEDVLQKDVVHWWOHGPRUHWKDQLQFKRUKDV URWDWHGPRUHWKDQLQFKHVRXWRIDOLJQPHQW %DVLQUHSODFHGRUUHSDLUHGWRGHVLJQ VWDQGDUGV 'DPDJHGSLSHMRLQWV &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ WKHFDWFKEDVLQDWWKHMRLQWRIWKHLQOHWRXWOHW SLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRILQOHWRXWOHWSLSHV &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQ D VXUIDFHRLOILOP ,QOHW2XWOHW3LSH 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWILOOLQJRUPRUHRIWKHSLSH ,QOHWRXWOHWSLSHVFOHDURIVHGLPHQW 7UDVKDQGGHEULV 7UDVKDQGGHEULVDFFXPXODWHGLQLQOHWRXWOHW SLSHVLQFOXGHVIORDWDEOHVDQGQRQIORDWDEOHV 1RWUDVKRUGHEULVLQSLSHV 'DPDJHG &UDFNVZLGHUWKDQòLQFKDWWKHMRLQWRIWKH LQOHWRXWOHWSLSHVRUDQ\HYLGHQFHRIVRLOHQWHULQJ DWWKHMRLQWV RIWKHLQOHWRXWOHWSLSHV 1RFUDFNVPRUHWKDQóLQFKZLGHDW WKHMRLQWRIWKHLQOHWRXWOHWSLSH 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &$7&+%$6,16 $1'0$1+2/(6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQ:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 0HWDO*UDWHV &DWFK%DVLQV 8QVDIHJUDWHRSHQLQJ *UDWHZLWKRSHQLQJZLGHUWKDQ LQFK *UDWHRSHQLQJPHHWVGHVLJQ VWDQGDUGV 7UDVKDQGGHEULV 7UDVKDQGGHEULVWKDWLVEORFNLQJPRUHWKDQ RIJUDWHVXUIDFH *UDWHIUHHRIWUDVKDQGGHEULV IRRWQRWHWRJXLGHOLQHVIRUGLVSRVDO 'DPDJHGRUPLVVLQJ *UDWHPLVVLQJRUEURNHQPHPEHUVRIWKHJUDWH $Q\RSHQVWUXFWXUHUHTXLUHVXUJHQW PDLQWHQDQFH *UDWHLVLQSODFHDQGPHHWVGHVLJQ VWDQGDUGV 0DQKROH&RYHU/LG &RYHUOLGQRWLQSODFH &RYHUOLGLVPLVVLQJRURQO\SDUWLDOO\LQSODFH $Q\RSHQVWUXFWXUHUHTXLUHVXUJHQW PDLQWHQDQFH &RYHUOLGSURWHFWVRSHQLQJWR VWUXFWXUH /RFNLQJPHFKDQLVP 1RW:RUNLQJ 0HFKDQLVP FDQQRWEHRSHQHGE\RQH PDLQWHQDQFHSHUVRQZLWKSURSHUWRROV%ROWV FDQQRWEHVHDWHG6HOIORFNLQJFRYHUOLGGRHVQRW ZRUN 0HFKDQLVPRSHQVZLWKSURSHUWRROV &RYHUOLGGLIILFXOWWR 5HPRYH 2QHPDLQWHQDQFHSHUVRQFDQQRWUHPRYH FRYHUOLGDIWHUDSSO\LQJOEVRIOLIW &RYHUOLGFDQEHUHPRYHGDQG UHLQVWDOOHGE\RQHPDLQWHQDQFH SHUVRQ 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± &219(<$1&( 3,3(6$1'',7&+(6 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 3LSHV 6HGLPHQW GHEULV DFFXPXODWLRQ $FFXPXODWHGVHGLPHQWRUGHEULVWKDWH[FHHGV RIWKHGLDPHWHURIWKHSLSH :DWHUIORZVIUHHO\WKURXJKSLSHV 9HJHWDWLRQURRWV 9HJHWDWLRQURRWVWKDWUHGXFHIUHHPRYHPHQWRI ZDWHUWKURXJKSLSHV :DWHUIORZVIUHHO\WKURXJKSLSHV &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP 'DPDJHWRSURWHFWLYH FRDWLQJRUFRUURVLRQ 3URWHFWLYHFRDWLQJLVGDPDJHGUXVWRUFRUURVLRQ LVZHDNHQLQJWKHVWUXFWXUDOLQWHJULW\RIDQ\SDUWRI SLSH 3LSHUHSDLUHGRUUHSODFHG 'DPDJHG $Q\GHQWWKDWGHFUHDVHVWKHFURVVVHFWLRQDUHD RISLSHE\PRUHWKDQRULVGHWHUPLQHGWR KDYHZHDNHQHGVWUXFWXUDOLQWHJULW\RIWKHSLSH 3LSHUHSDLUHGRUUHSODFHG 'LWFKHV 7UDVKDQGGHEULV 7UDVKDQGGHEULVH[FHHGVFXELFIRRWSHU VTXDUHIHHWRIGLWFKDQGVORSHV 7UDVKDQGGHEULVFOHDUHGIURP GLWFKHV 6HGLPHQW DFFXPXODWLRQ $FFXPXODWHGVHGLPHQWWKDWH[FHHGVRIWKH GHVLJQGHSWK 'LWFKFOHDQHGIOXVKHGRIDOO VHGLPHQWDQGGHEULVVRWKDWLW PDWFKHVGHVLJQ 1R[LRXVZHHGV $Q\QR[LRXVRUQXLVDQFHYHJHWDWLRQZKLFKPD\ FRQVWLWXWHDKD]DUGWR&RXQW\SHUVRQQHORUWKH SXEOLF 1R[LRXVDQGQXLVDQFHYHJHWDWLRQ UHPRYHGDFFRUGLQJWRDSSOLFDEOH UHJXODWLRQV1RGDQJHURIQR[LRXV YHJHWDWLRQZKHUH&RXQW\SHUVRQQHO RUWKHSXEOLFPLJKWQRUPDOO\EH &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP 9HJHWDWLRQ 9HJHWDWLRQWKDWUHGXFHVIUHHPRYHPHQWRIZDWHU WKURXJKGLWFKHV :DWHUIORZVIUHHO\WKURXJKGLWFKHV (URVLRQGDPDJHWR VORSHV $Q\HURVLRQREVHUYHGRQDGLWFKVORSH 6ORSHVDUHQRWHURGLQJ 5RFNOLQLQJRXWRI SODFHRUPLVVLQJ,I $SSOLFDEOH 2QHOD\HURUOHVVRIURFNH[LVWVDERYHQDWLYHVRLO DUHDVTXDUHIHHWRUPRUHDQ\H[SRVHGQDWLYH VRLO 5HSODFHURFNVWRGHVLJQVWDQGDUGV 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&( 5(48,5(0(176)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± *5281'6 /$1'6&$3,1* 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 6LWH 7UDVKRUOLWWHU $Q\WUDVKDQGGHEULVZKLFKH[FHHGFXELFIRRW SHUVTXDUHIHHWWKLVLVDERXWHTXDOWRWKH DPRXQWRIWUDVKLWZRXOGWDNHWRILOOXSRQH VWDQGDUGVL]HRIILFHJDUEDJHFDQ,QJHQHUDO WKHUHVKRXOGEHQRYLVXDOHYLGHQFHRIGXPSLQJ 7UDVKDQGGHEULVFOHDUHGIURPVLWH 1R[LRXVZHHGV $Q\QR[LRXVRUQXLVDQFHYHJHWDWLRQZKLFKPD\ FRQVWLWXWHDKD]DUGWR&RXQW\SHUVRQQHORUWKH SXEOLF 1R[LRXVDQGQXLVDQFHYHJHWDWLRQ UHPRYHGDFFRUGLQJWRDSSOLFDEOH UHJXODWLRQV1RGDQJHURIQR[LRXV YHJHWDWLRQZKHUH&RXQW\SHUVRQQHO RUWKHSXEOLFPLJKWQRUPDOO\EH &RQWDPLQDQWVDQG SROOXWLRQ $Q\HYLGHQFHRIFRQWDPLQDQWVRUSROOXWLRQVXFK DVRLOJDVROLQHFRQFUHWHVOXUULHV RUSDLQW 0DWHULDOVUHPRYHGDQGGLVSRVHGRI DFFRUGLQJWRDSSOLFDEOHUHJXODWLRQV 6RXUFHFRQWURO%03VLPSOHPHQWHGLI DSSURSULDWH1RFRQWDPLQDQWV SUHVHQWRWKHUWKDQDVXUIDFHRLOILOP *UDVVJURXQGFRYHU *UDVVRUJURXQGFRYHU H[FHHGVLQFKHVLQ KHLJKW *UDVVRUJURXQGFRYHUPRZHGWRD KHLJKWQRJUHDWHUWKDQLQFKHV 7UHHVDQG6KUXEV +D]DUG $Q\WUHHRUOLPERIDWUHHLGHQWLILHGDVKDYLQJD SRWHQWLDOWRIDOODQGFDXVHSURSHUW\GDPDJHRU WKUHDWHQKXPDQOLIH$KD]DUGWUHHLGHQWLILHGE\ DTXDOLILHGDUERULVWPXVWEHUHPRYHGDVVRRQ DVSRVVLEOH 1RKD]DUGWUHHVLQIDFLOLW\ 'DPDJHG /LPEVRUSDUWVRIWUHHVRUVKUXEVWKDWDUHVSOLWRU EURNHQZKLFKDIIHFWPRUHWKDQRIWKHWRWDO IROLDJHRIWKHWUHHRUVKUXE 7UHHVDQG VKUXEVZLWKOHVVWKDQ RIWRWDOIROLDJHZLWKVSOLWRUEURNHQ OLPEV 7UHHVRUVKUXEVWKDWKDYHEHHQEORZQGRZQRU NQRFNHGRYHU 1REORZQGRZQYHJHWDWLRQRU NQRFNHGRYHUYHJHWDWLRQ7UHHVRU VKUXEVIUHHRILQMXU\ 7UHHVRUVKUXEVZKLFKDUHQRWDGHTXDWHO\ VXSSRUWHGRUDUHOHDQLQJRYHUFDXVLQJH[SRVXUH RIWKHURRWV 7UHHRUVKUXELQSODFHDQG DGHTXDWHO\VXSSRUWHGGHDGRU GLVHDVHGWUHHVUHPRYHG 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ $33(1',;$ 0$,17(1$1&(5(48,5(0(176)25)/2:&21752/&219(<$1&($1':4)$&,/,7,(6 12± %,25(7(17,21 %03 0DLQWHQDQFH &RPSRQHQW 'HIHFWRU3UREOHP &RQGLWLRQV:KHQ0DLQWHQDQFHLV1HHGHG 5HVXOWV([SHFWHG:KHQ 0DLQWHQDQFHLV3HUIRUPHG 3UHYHQWDWLYH 9HJHWDWLRQ 9HJHWDWLRQWREHZDWHUHGDQGSUXQHGDV QHHGHGDQGPXOFKDSSOLHGWRDPLQLPXPRI LQFKHVWRPDLQWDLQKHDOWK\JURZWK +HDOWK\YHJHWDWLRQJURZWKZLWKIXOO FRYHUDJHDVGHVLJQHG %LRUHWHQWLRQ$UHD 7UDVKDQGGHEULV 7UDVKDQGGHEULVLQWKHELRUHWHQWLRQDUHDOHDI GURSLQWKHIDOOVHDVRQ 1RWUDVKRUGHEULV,QWKHELRUHWHQWLRQ DUHD 6HGLPHQW DFFXPXODWLRQ 6HGLPHQWDFFXPXODWLRQLQWKHELRUHWHQWLRQDUHD LQWHUIHULQJZLWKLQILOWUDWLRQ :DWHULQWKHELRUHWHQWLRQLQILOWUDWHVDV GHVLJQHG 3RQGLQJ 6WDQGLQJZDWHULQWKHELRUHWHQWLRQDUHDIRU PRUHWKDQWZR GD\V 6WDQGLQJZDWHULQILOWUDWHVDWWKH GHVLUHGUDWH ,QIORZ ,QIORZQRWJHWWLQJLQWRELRUHWHQWLRQ GHEULVVHGLPHQWEORFNDJHDWLQOHWIHDWXUHV QDWLYHVRLOLVH[SRVHGRURWKHUVLJQVRIHURVLRQ GDPDJHLVSUHVHQW 8QREVWUXFWHG DQGSURSHUO\URXWHG LQIORZLQWRELRUHWHQWLRQDUHDLQOHW LV VWDELOL]HGDQGDSSURSULDWHO\DUPRUHG 2YHUIORZRXWOHW 2YHUIORZZDWHUQRWFRQWUROOHGE\RXWOHW IHDWXUHV QDWLYHVRLOLVH[SRVHGRURWKHUVLJQV RIHURVLRQGDPDJHLVSUHVHQW 2XWOHWIHDWXUHVFRQWURORYHUIORZ RYHUIORZLVVWDELOL]HGDQGDSSURSULDWHO\ DUPRUHG 8QGHUGUDLQ 8QGHUGUDLQLVQRWIORZLQJZKHQELRUHWHQWLRQ DUHDKDVEHHQLQILOWUDWLQJZDWHU 8QGHUGUDLQIORZVIUHHO\ZKHQZDWHU LV SUHVHQW 9HJHWDWLRQ 3ODQWKHDOWK 3ODQWVQRWWKULYLQJ DFURVVDWOHDVWRIWKH HQWLUHGHVLJQYHJHWDWHGDUHDZLWKLQWKH%03 RYHUO\GHQVHYHJHWDWLRQUHTXLULQJSUXQLQJ +HDOWK\ZDWHUWROHUDQWSODQWVLQ ELRUHWHQWLRQDUHDSODQWVWKULYLQJ DFURVVDWOHDVW RIWKHHQWLUH GHVLJQYHJHWDWHGDUHDZLWKLQWKH IDFLOLW\ 3ODQWVSHFLHV 3ODQWVQRWZDWHUWROHUDQWVSHFLHV 3ODQWVDUHZDWHUWROHUDQW :HHGV :HHGVJURZLQJLQELRUHWHQWLRQDUHD 1RZHHGVLQELRUHWHQWLRQDUHD :DWHULQJ 3ODQWLQJVFKHGXOHUHTXLUHVIUHTXHQWZDWHULQJ DSSUR[ZHHNO\<HDUELPRQWKO\<HDUVDQG IRUQHZIDFLOLWLHVDQGDVQHHGHGIRU HVWDEOLVKHGSODQWLQJVRUGU\SHULRGV 3ODQWVDUHHVWDEOLVKHGDQGWKULYLQJ 3HVW&RQWURO 6LJQVRISHVWVVXFKDVZLOWLQJRUFKHZHG OHDYHVRUEDUNVSRWWLQJ RURWKHULQGLFDWRUV H[WHQGHGSRQGLQJSHULRGHQFRXUDJLQJ PRVTXLWRHV 3ODQWFRPPXQLW\LVSHVWIUHHZKHQ IROORZLQJDQDSSURYHG,QWHJUDWHG3HVW 0DQDJHPHQWSODQELRUHWHQWLRQ IXQFWLRQLQJQRUPDOO\DQGSRQGLQJ FRQWUROOHGDVQHHGHGIRUSHVWFRQWURO &RQWDLQPHQW%HUP DQG (DUWKHQ6ORSHV (URVLRQ (URVLRQRFFXUULQJDWHDUWKHQVORSHVRU FRQWDLQPHQWEHUPVLGHVORSH (URVLRQ RQWKHFRQWDLQPHQWEHUP DQG VLGHVORSHV KDV EHHQUHSDLUHGDQGWKH FDXVHRIWKHHURVLRQFRUUHFWHG 9RLGVFUHDWHGE\ QXLVDQFHDQLPDOV HJURGHQWVRUWUHH URRWV 9RLGVDIIHFWLQJEHUPLQWHJULW\RUFUHDWLQJOHDN\ SRQGFRQGLWLRQ 9RLGVKDYHEHHQUHSDLUHG IDFLOLW\LV IUHHRIQXLVDQFHDQLPDOVIROORZLQJDQ DSSURYHG,QWHJUDWHG3HVW 0DQDJHPHQWSODQ 6HWWOHPHQW $Q\SDUWRIWKHFRQWDLQPHQWEHUPWRSKDVOHVV WKDQLQFKHVRIIUHHERDUGIURPWKHPD[LPXP SRQGOHYHOWRWKHWRSRIWKHEHUP $PLQLPXPRILQFKHVIUHHERDUGIURP WKHPD[LPXPSRQGOHYHOWRWKHWRSRI WKHEHUP $PHQGHG6RLO 6RLOQXWULHQWV 6RLOQRWSURYLGLQJSODQWQXWULHQWV 6RLOSURYLGLQJSODQWQXWULHQWV %DUHVSRWV %DUHVSRWVRQVRLOLQELRUHWHQWLRQDUHD 1REDUHVSRWVELRUHWHQWLRQDUHD FRYHUHGZLWKYHJHWDWLRQRUPXOFK PL[HGLQWRWKHXQGHUO\LQJVRLO &RPSDFWLRQ 3RRULQILOWUDWLRQGXHWRVRLOFRPSDFWLRQLQWKH ELRUHWHQWLRQDUHD 1RVRLOFRPSDFWLRQLQWKHELRUHWHQWLRQ DUHD ,QVSHFWLRQ )UHTXHQF\ $QQXDOO\DQGDIWHUODUJHVWRUPV DQGDV QHHGHGVHDVRQDOO\ IRUSUXQLQJSODQW PDLQWHQDQFHSHVWFRQWURO DQG WRFRQWUROOHDI GURSHYHUJUHHQQHHGOHVHWF %LRUHWHQWLRQIDFLOLW\ LVIXQFWLRQLQJ QRUPDOO\ SODQW FRPPXQLW\LVWKULYLQJ DQGSHVWIUHH 6XUIDFH:DWHU'HVLJQ0DQXDO± $SSHQGL[$ $ APPENDIX G: BOND QUANTITIES WORKSHEET Site Improvement Bond Quantity WorksheetS15 Web date: 04/03/2015 Department of Permitting & Environmental Review35030 SE Douglas Street, Suite 210Snoqualmie, Washington 98065-9266206-296-6600 TTY Relay 711Project Name: Date: Location: Project No.: Activity No.: Note: All prices include labor, equipment, materials, overhead and Clearing greater than or equal to 5,000 board feet of timber? profit. Prices are from RS Means data adjusted for the Seattle area or from local sources if not included in the RS Means database. yesxno If yes, Forest Practice Permit Number: (RCW 76.09)Page 1 of 9Jump Start Espresso 3450 SW 320th Street, Federal Way, WA 98023For alternate formats, call 206-296-6600. __________________10/2/2020 Cost Estimate.xlsUnit prices updated: 3/2/2015 Version: 3/2/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetS15 Web date: 04/03/2015 Unit # ofReference # Price Unit Quantity Applications CostEROSION/SEDIMENT CONTROLNumberBackfill & compaction-embankmentESC-16.00$ CYCheck dams, 4" minus rockESC-2SWDM 5.4.6.3 80.00$ Each Crushed surfacing 1 1/4" minusESC-3WSDOT 9-03.9(3) 95.00$ CYDitchingESC-49.00$ CY Excavation-bulkESC-52.00$ CYFence, siltESC-6SWDM 5.4.3.1 1.50$ LF 528 1792Fence, Temporary (NGPE)ESC-71.50$ LFHydroseedingESC-8SWDM 5.4.2.4 0.80$ SY Jute MeshESC-9SWDM 5.4.2.2 3.50$ SYMulch, by hand, straw, 3" deepESC-10SWDM 5.4.2.1 2.50$ SYMulch, by machine, straw, 2" deepESC-11SWDM 5.4.2.1 2.00$ SYPiping, temporary, CPP, 6"ESC-1212.00$ LFPiping, temporary, CPP, 8"ESC-1314.00$ LFPiping, temporary, CPP, 12"ESC-1418.00$ LFPlastic covering, 6mm thick, sandbaggedESC-15SWDM 5.4.2.3 4.00$ SYRip Rap, machine placed; slopesESC-16WSDOT 9-13.1(2) 45.00$ CYRock Construction Entrance, 50'x15'x1'ESC-17SWDM 5.4.4.1 1,800.00$ Each 1 11800Rock Construction Entrance, 100'x15'x1'ESC-18SWDM 5.4.4.1 3,200.00$ Each Sediment pond riser assemblyESC-19SWDM 5.4.5.2 2,200.00$ EachSediment trap, 5' high berm ESC-20SWDM 5.4.5.1 19.00$ LFSed. trap, 5' high, riprapped spillway berm section ESC-21SWDM 5.4.5.1 70.00$ LFSeeding, by handESC-22SWDM 5.4.2.4 1.00$ SYSodding, 1" deep, level groundESC-23SWDM 5.4.2.5 8.00$ SYSodding, 1" deep, sloped groundESC-24SWDM 5.4.2.5 10.00$ SYTESC SupervisorESC-25110.00$ HRWater truck, dust controlESC-26SWDM 5.4.7 140.00$ HRWRITE-IN-ITEMS **** (see page 9)EachESC SUBTOTAL:2,592.00$ 30% CONTINGENCY & MOBILIZATION:777.60$ ESC TOTAL:3,369.60$ COLUMN: APage 2 of 9Cost Estimate.xlsUnit prices updated: 3/2/2015 Version: 3/2/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Existing Future Public PrivateRight-of-Way Right of Way ImprovementsUnit Price Unit Quant. Cost Quant. Cost Quant. CostGENERAL ITEMSNo.Backfill & Compaction- embankmentGI - 1 6.00$ CY Backfill & Compaction- trenchGI - 2 9.00$ CYClear/Remove Brush, by handGI - 3 1.00$ SYClearing/Grubbing/Tree RemovalGI - 4 10,000.00$ Acre Excavation - bulkGI - 5 2.00$ CY Excavation - TrenchGI - 6 5.00$ CYFencing, cedar, 6' highGI - 7 20.00$ LFFencing, chain link, vinyl coated, 6' highGI - 8 20.00$ LFFencing, chain link, gate, vinyl coated, 20GI - 9 1,400.00$ EachFencing, split rail, 3' high GI - 10 15.00$ LFFill & compact - common barrow GI - 11 25.00$ CYFill & compact - gravel base GI - 12 27.00$ CYFill & compact - screened topsoil GI - 13 39.00$ CYGabion, 12" deep, stone filled mesh GI - 14 65.00$ SYGabion, 18" deep, stone filled mesh GI - 15 90.00$ SYGabion, 36" deep, stone filled mesh GI - 16 150.00$ SYGrading, fine, by hand GI - 17 2.50$ SYGrading, fine, with grader GI - 18 2.00$ SYMonuments, 3' long GI - 19 250.00$ Each Sensitive Areas Sign GI - 20 7.00$ EachSodding, 1" deep, sloped ground GI - 21 8.00$ SYSurveying, line & grade GI - 22 850.00$ DaySurveying, lot location/lines GI - 23 1,800.00$ AcreTraffic control crew ( 2 flaggers ) GI - 24 120.00$ HRTrail, 4" chipped wood GI - 25 8.00$ SYTrail, 4" crushed cinder GI - 26 9.00$ SYTrail, 4" top course GI - 27 12.00$ SYWall, retaining, concrete GI - 28 55.00$ SF601.44 33,079.20Wall, rockery GI - 29 15.00$ SF Page 3 of 9 SUBTOTAL33,079.20 & Drainage Facilities*KCC 27A authorizes only one bond reduction.Cost Estimate.xlsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Existing Future PublicRight-of-way Right of Way ImprovementsUnit Price Unit Quant. Cost Quant. Cost Quant. CostROAD IMPROVEMENTNo.AC Grinding, 4' wide machine < 1000syRI - 1 30.00$ SYAC Grinding, 4' wide machine 1000-2000sRI - 2 16.00$ SYAC Grinding, 4' wide machine > 2000syRI - 3 10.00$ SYAC Removal/DisposalRI - 4 35.00$ SYBarricade, type III ( Permanent )RI - 6 56.00$ LFCurb & Gutter, rolledRI - 7 17.00$ LF Curb & Gutter, verticalRI - 8 12.50$ LF Curb and Gutter, demolition and disposalRI - 9 18.00$ LFCurb, extruded asphaltRI - 10 5.50$ LFCurb, extruded concreteRI - 11 7.00$ LF 84 588.00 614 4,298.00Sawcut, asphalt, 3" depthRI - 12 1.85$ LF Sawcut, concrete, per 1" depthRI - 13 3.00$ LFSealant, asphaltRI - 14 2.00$ LF Shoulder, AC, ( see AC road unit price )RI - 15 -$ SYShoulder, gravel, 4" thickRI - 16 15.00$ SYSidewalk, 4" thickRI - 17 38.00$ SY 84 3,192.00 127 4,826.00Sidewalk, 4" thick, demolition and disposaRI - 18 32.00$ SY 84 2,688.00Sidewalk, 5" thickRI - 19 41.00$ SY Sidewalk, 5" thick, demolition and disposaRI - 20 40.00$ SYSign, handicap RI - 21 85.00$ Each2 170.00Striping, per stall RI - 22 7.00$ EachStriping, thermoplastic, ( for crosswalk ) RI - 23 3.00$ SF40 120.00Striping, 4" reflectorized line RI - 24 0.50$ LFPage 4 of 9 SUBTOTAL 6,468.00 9,414.00Private & Drainage Facilities*KCC 27A authorizes only one bond reduction.Cost Estimate.xlsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Existing Future Public PrivateRight-of-way Right of Way ImprovementsUnit Price Unit Quant. Cost Quant. Cost Quant. CostROAD SURFACING No. (4" Rock = 2.5 base & 1.5" top course) 9 1/2" Rock= 8" base & 1.5" top course)Additional 2.5" Crushed SurfacingRS - 1 3.60$ SY HMA 1/2" Overlay, 1.5" RS - 2 14.00$ SYHMA 1/2" Overlay 2"RS - 3 18.00$ SYHMA Road, 2", 4" rock, First 2500 SYRS - 4 28.00$ SYHMA Road, 2", 4" rock, Qty. over 2500 SYRS - 5 21.00$ SYHMA Road, 3", 9 1/2" Rock, First 2500 SYRS - 6 42.00$ SYHMA Road, 3", 9 1/2" Rock, Qty Over 250RS - 7 35.00$ SYNot UsedRS - 8Not UsedRS - 9HMA Road, 6" Depth, First 2500 SYRS - 10 33.10$ SY HMA Road, 6" Depth, Qty. Over 2500 SYRS - 11 30.00$ SYHMA 3/4" or 1", 4" DepthRS - 12 20.00$ SYGravel Road, 4" rock, First 2500 SYRS - 13 15.00$ SYGravel Road, 4" rock, Qty. over 2500 SYRS - 14 10.00$ SYPCC Road (Add Under Write-Ins w/DesignRS - 15Thickened Edge RS - 17 8.60$ LFPage 5 of 9 SUBTOTAL & Drainage Facilities*KCC 27A authorizes only one bond reduction.Cost Estimate.xlsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Existing Future Public PrivateRight-of-way Right of Way ImprovementsUnit Price Unit Quant. Cost Quant. Cost Quant. CostDRAINAGE (CPP = Corrugated Plastic Pipe, N12 or Equivalent)Access Road, R/D D - 1 21.00$ SY Bollards - fixed D - 2 240.74$ EachBollards - removable D - 3 452.34$ Each* (CBs include frame and lid)CB Type I D - 4 1,500.00$ Each 6 9,000.00CB Type IL D - 5 1,750.00$ EachCB Type II, 48" diameter D - 6 2,300.00$ Each for additional depth over 4' D - 7 480.00$ FT CB Type II, 54" diameter D - 8 2,500.00$ Each1 2,500.00 for additional depth over 4' D - 9 495.00$ FTCB Type II, 60" diameter D - 10 2,800.00$ Each for additional depth over 4' D - 11 600.00$ FTCB Type II, 72" diameter D - 12 3,600.00$ Each for additional depth over 4' D - 13 850.00$ FTThrough-curb Inlet Framework (Add) D - 14 400.00$ EachCleanout, PVC, 4" D - 15 150.00$ EachCleanout, PVC, 6" D - 16 170.00$ Each Cleanout, PVC, 8" D - 17 200.00$ Each Culvert, PVC, 4" D - 18 10.00$ LFCulvert, PVC, 6" D - 19 13.00$ LF Culvert, PVC, 8" D - 20 15.00$ LF Culvert, PVC, 12" D - 21 23.00$ LF257 5,911.00Culvert, CMP, 8" D - 22 19.00$ LFCulvert, CMP, 12" D - 23 29.00$ LFCulvert, CMP, 15" D - 24 35.00$ LFCulvert, CMP, 18" D - 25 41.00$ LFCulvert, CMP, 24" D - 26 56.00$ LFCulvert, CMP, 30" D - 27 78.00$ LFCulvert, CMP, 36" D - 28 130.00$ LFCulvert, CMP, 48" D - 29 190.00$ LFCulvert, CMP, 60" D - 30 270.00$ LFCulvert, CMP, 72" D - 31 350.00$ LFPage 6 of 9 SUBTOTAL 17,411.00 & Drainage Facilities For Culvert prices, Average of 4' cover was assumed. Assume perforated PVC is same price as solid pipe.*KCC 27A authorizes only one bond reduction.Cost Estimate.xlsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Existing Future Public PrivateRight-of-way Right of Way ImprovementsDRAINAGE CONTINUEDNo. Unit Price Unit Quant. Cost Quant. Cost Quant. CostCulvert, Concrete, 8" D - 32 25.00$ LFCulvert, Concrete, 12" D - 33 36.00$ LFCulvert, Concrete, 15" D - 34 42.00$ LFCulvert, Concrete, 18" D - 35 48.00$ LFCulvert, Concrete, 24" D - 36 78.00$ LFCulvert, Concrete, 30" D - 37 125.00$ LFCulvert, Concrete, 36" D - 38 150.00$ LFCulvert, Concrete, 42" D - 39 175.00$ LFCulvert, Concrete, 48" D - 40 205.00$ LFCulvert, CPP, 6" D - 41 14.00$ LFCulvert, CPP, 8" D - 42 16.00$ LFCulvert, CPP, 12" D - 43 24.00$ LF Culvert, CPP, 15" D - 44 35.00$ LF Culvert, CPP, 18" D - 45 41.00$ LFCulvert, CPP, 24" D - 46 56.00$ LF Culvert, CPP, 30" D - 47 78.00$ LFCulvert, CPP, 36" D - 48 130.00$ LFDitching D - 49 9.50$ CYFlow Dispersal Trench (1,436 base+) D - 50 28.00$ LFFrench Drain (3' depth) D - 51 26.00$ LFGeotextile, laid in trench, polypropylene D - 52 3.00$ SYMid-tank Access Riser, 48" dia, 6' deep D - 54 2,000.00$ EachPond Overflow Spillway D - 55 16.00$ SYRestrictor/Oil Separator, 12" D - 56 1,150.00$ EachRestrictor/Oil Separator, 15" D - 57 1,350.00$ EachRestrictor/Oil Separator, 18" D - 58 1,700.00$ Each Riprap, placed D - 59 42.00$ CY Tank End Reducer (36" diameter) D - 60 1,200.00$ EachTrash Rack, 12" D - 61 350.00$ EachTrash Rack, 15" D - 62 410.00$ EachTrash Rack, 18" D - 63 480.00$ EachTrash Rack, 21" D - 64 550.00$ EachPage 7 of 9 SUBTOTAL & Drainage Facilities*KCC 27A authorizes only one bond reduction.Cost Estimate.xlsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Existing Future Public PrivateRight-of-way Right of Way ImprovementsUnit Price Unit Quant. Price Quant. Cost Quant. CostPARKING LOT SURFACINGNo.2" AC, 2" top course rock & 4" borrowPL - 1 21.00$ SY NA NA 931.5 19561.52" AC, 1.5" top course & 2.5" base coursPL - 2 28.00$ SY NA NA4" select borrowPL - 3 5.00$ SY NA NA1.5" top course rock & 2.5" base coursePL - 4 14.00$ SY NA NAUTILITY POLES & STREET LIGHTINGUtility pole relocation costs must be accompanied by Franchise Utility's Cost EstimateUtility Pole(s) RelocationUP-1Street Light Poles w/LuminairesUP-2 7,500.00$ Each WRITE-IN-ITEMS(Such as detention/water quality vaults.)No.Stormwater VaultWI - 1 380,000.00$ Each Block WallWI - 2 16.00$ SY Yard DrainWI - 3 225.00$ CY WI - 4 LFWI - 5 FTWI - 6WI - 7WI - 8WI - 9WI - 10SUBTOTAL SUBTOTAL (SUM ALL PAGES):6,468.00 79,465.7030% CONTINGENCY & MOBILIZATION:1,940.40 23,839.71 GRANDTOTAL: 8,408.40 103,305.41COLUMN: B C DPage 8 of 9Lump Sum & Drainage FacilitiesNot To Be Used For Roads Or Shoulders*KCC 27A authorizes only one bond reduction.Cost Estimate.xlsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 Site Improvement Bond Quantity WorksheetWeb date: 04/03/2015Original bond computations prepared by:Name:Date:PE Registration Number:Tel. #:Firm Name:Address:Project No: Stabilization/Erosion Sediment Control (ESC)(A)Existing Right-of-Way Improvements(B)Future Public Right of Way & Drainage Facilities(C)Private Improvements(D)Calculated Quantity CompletedTotal Right-of Way and/or Site Restoration Bond*/**(A+B)(First $7,500 of bond* shall be cash.)Performance Bond* Amount (A+B+C+D) = TOTAL (T) T x 0.30Minimum is $2000. Minimum is $2000.Maintenance/Defect Bond* TotalMinimum is $2000.NAME OF PERSON PREPARING BOND* REDUCTION:Date:* NOTE:The word "bond" as used in this document means a financial guarantee acceptable to King County.** NOTE: KCC 27A authorizes right of way and site restoration bonds to be combined when both are required. The restoration requirement shall include the total cost for all TESC as a minimum, not a maximum. In addition, corrective work, both on- and off-site needs to be included. Quantities shall reflect worse case scenarios not just minimum requirements. For example, if a salmonid stream may be damaged, some estimated costs for restoration needs to be reflected in this amount. The 30% contingency and mobilization costs are computed in this quantity.*** NOTE: Per KCC 27A, total bond amounts remaining after reduction shall not be less than 30% of the original amount (T) or as revised by major design changes.REQUIRED BOND* AMOUNTS ARE SUBJECT TO REVIEW AND MODIFICATION BY KING COUNTY10/2/2020(253) 737-4173 FINANCIAL GUARANTEE REQUIREMENTSPUBLIC ROAD & DRAINAGE MAINTENANCE/DEFECT BOND*Adam E. PaulAP Consulting Engineers PLLCPO Box 162, Auburn, WA 98071PERFORMANCE BOND*AMOUNT MINIMUM BOND* AMOUNT REQUIRED FOR RECORDING ORTEMPORARY OCCUPANCY AT SUBSTANTIAL COMPLETION *** 2,102.1$ 3,369.6$ 8,408.4$ -$ 34,525.0$ (B+C) x 0.25 =11,778.0$ 103,305.4$ 115,083.4$ Page 9 of 9Cost Estimate.xlsCheck out the DDES Web site at www.kingcounty.gov/permitsUnit prices updated: 03/02/2015Version: 03/02/2015Report Date: 10/6/2020 APPENDIX H: SOURCE CONTROL MEASURES Stormwater Pollution Prevention Manual • King County 27 A-1 Required Best Management Practices for all Properties with Commercial Activities The following Best Management Practices (BMPs) are required for all commercial, industrial, agricultural, public, or residential properties with commercial activities in unincorporated King County. Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: Clean and Maintain Storm Drainage System • Evaluate the condition of the catch basin by checking the amount of sediment in the bottom of the sump. Catch basins must be cleaned out when the solids, trash, and debris in the sump reaches one–half of the depth between the bottom of the sump and the bottom of the lowest inflow or outflow pipe connected to the catch basin or is at least 6 inches below this point. • Hire a professional drainage contractor to inspect and maintain your system or clean the system yourself. If there is sediment or other debris in the drainage pipes, then a professional contractor must be hired to flush or jet out the pipes. • Small amounts of floating oil can be soaked up with oil absorbent pads, bagged and disposed of as solid waste. • Up to one cubic yard of nonhazardous solid material may be disposed of as solid waste in your regular garbage. If you exceed this threshold hire a professional drainage contractor. All of the solids and stagnant water collected from catch basin sumps must be disposed of properly. None of the sump contents can be flushed into the catch basin outflow pipe. Depending on the nature of the pollutants in the sump, and the associated types of activities taking place on the site, the sump contents may need to be handled as contaminated waste. Contractors who perform catch basin clean–out services are required to follow appropriate disposal requirements. • Clean and maintain catch basins annually. Sites with activities generating a lot of sediments and other debris will have to inspect and clean out their catch basins more often. Frequent sweeping of paved parking and storage areas will save time and money in maintaining the drainage system. • Other components of drainage systems such as ponds, tanks, and bioswales must also be maintained. If this maintenance is beyond your ability, contractors are available to complete this work. Label All Storm Drain Inlets on Your Property • Stencil or apply storm drain markers adjacent to storm drains to help prevent the improper disposal of pollutants. If the storm drain grate is stamped with warnings against polluting, then additional marking may not be required if there is no evidence of pollutants being dumped or washed into the storm drain. Stormwater Pollution Prevention Manual • King County28 Eliminate Illicit Connections to the Storm Drainage System • Connections to the storm drainage system that convey substances other than stormwater are prohibited. Examples are connections from internal floor drains, HVAC systems, industrial processes, sinks, and toilets. • Illicit connections must be immediately removed, permanently plugged or re–plumbed. • The discharge must be re–plumbed so that it goes to the sanitary sewer, a septic system, an on–site treatment system, or a holding tank for off–site disposal. There are restrictions on what can be disposed of to the sanitary sewer and septic systems. You may be required to do additional investigation to determine where all stormwater and non–stormwater discharges go. This may include smoke, dye, and chemical testing or closed circuit television inspection. Additional Information: • Drainage System Maintenance Contractors Information Sheet • For stencils and instructions or to determine if you have an illicit connection, contact King County Stormwater Services at 206–477–4811 or kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County42 A-15 Pressure Washing of Buildings, Rooftops, and Other Large Objects Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • If the area is paved and soaps, detergents or any other chemical (including pesticides) are used, use a sump pump, wet vacuum or similar device that enables collection of wash water and associated solids so they can be disposed of properly. The wash water must not go to the storm drain system. • If the area is paved but soaps and detergents are not being used, the wash water runoff does not have to be collected but it does have to be filtered to trap solid materials. • The wash water does not need to be collected if the area is landscaped and the water can soak into the ground without running into the storm drain system. • If the surface being pressure washed is painted with lead or other heavy metal–bearing paint (such as chromium or cadmium), you must use a commercial pressure washing service that will collect, test, and properly dispose of the wastewater. • Block or disconnect all rooftop downspouts when washing roofs. The wash/waste water must be directed to pervious areas such as landscaping or gravel for infiltration, collected and disposed of to the sanitary sewer, or taken off site for appropriate disposal. Additional Information: • Disposal Information sheet • Catch basin insert Information sheet Note: Pressure washing of boats in boat yards, marinas, and dry dock areas is covered by a National Pollutant Discharge Elimination System (NPDES) permit, administered by the Washington State Department of Ecology, so the BMPs listed above may not apply to pressure washing in these locations. For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County56 A-26 Landscaping Activities and Vegetation Management Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Train employees on the proper use and application of fertilizers and pesticides. • Never apply pesticides and fertilizers if it is raining or about to rain. • Do not apply pesticides within 100 feet of surface waters such as lakes, ponds, wetlands, streams, and stormwater conveyance ditches unless the application is approved and permitted by the Washington State Department of Ecology. • Determine the proper fertilizer application for the types of soil and vegetation involved. Follow manufacturers’ recommendations and label directions. • Clean up any spills immediately. • Remove weeds/vegetation in stormwater ditches by hand or other mechanical means and only use chemicals as a last resort. • Do not blow vegetation or other debris into the storm drain system, sidewalks, or street. Dispose of collected vegetation by recycling or composting. • Use mulch or other erosion control measures when soils are exposed for more than one week during the dry season or two days during the rainy season. • Ensure sprinkler systems do not “overspray” vegetated areas resulting in the excess water discharging into the storm drain system. • New and expanding golf courses must have a Golf Course Management Plan as described in addressed in the King County Golf Course BMP Manual Supplemental BMPs: • Use integrated pest management (IPM); a comprehensive approach to the use of pesticides is the most effective BMP measure that can be taken for herbicide, insecticide, and fungicide use. • Test soils to determine the correct fertilizer application rates. • Use mechanical methods of vegetation removal rather than applying herbicides. • Use native plants in landscaping. Native plants do not require extensive fertilizer or pesticide applications. Stormwater Pollution Prevention Manual • King County 57 Additional Information: • Storage of Pesticides and Fertilizers – Activity Sheets A-5 • Natural Yard Care Program: http://your.kingcounty.gov/solidwaste/naturalyardcare/watering.asp • The King County Golf Course BMP Manual. • The King County Noxious Weed Control Program provides best management practices for the removal of typical noxious weeds such as blackberry and purple loosestrife. Call 206–296–0290 or see: http://www.kingcounty.gov/environment/animalsandplants/noxious–weeds/weed–control–practices.aspx for more information. Washington pesticide law requires most businesses that commercially apply pesticides to the property of another to be licensed as a Commercial Applicator from the Washington State Department of Agriculture. For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County58 A-27 Clearing and Grading of Land for Small Construction Projects Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: Contact the King County Department of Design and Environmental Review (DPER) prior to clearing, grading, and preparation activities for construction sites greater than 2,000 square feet. Follow the procedures for construction site erosion and sediment control outlined in the King County Surface Water Design Manual, Appendix D Erosion and Sediment Control Standards. King County DPER coordinates the clearing, grading, and erosion control requirements on individual sites. The King County Surface Water Design Manual has requirements for erosion and sediment control measures. Appendix D (Erosion and Sediment Control Standards) outlines requirements that all sites must implement. The King County Surface Water Design Manual Appendix C (Small Project Drainage Requirements) addresses small project developments. Even if your site does not require a permit, erosion control measures are still required to prevent turbid water from entering drainage systems or surface waters. For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County 59 A-28 Demolition of Buildings Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Sweep surrounding street gutters, sidewalks, driveways, and other paved surfaces as needed to collect loose debris and garbage. Properly dispose of collected debris and garbage. Do not hose down the area to a storm drain. • Handle and dispose of all waste materials and demolition debris in a manner that does not cause contamination of stormwater. • Control dust and fine material using water or dust suppression products, avoiding excessive application to prevent runoff. • Install catch basin inserts to prevent particles and solids from entering the storm drainage system. • Inspect and maintain catch basin inserts to ensure they are working correctly. Additional Information: • Catch Basin Insert Information Sheet • Surface Water Design Manual Construction and Erosion BMPs Appendix D For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County 63 A-31 Vehicle and Equipment Parking and Storage Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Sweep parking lots, storage areas, and driveways as needed to collect dirt, waste, and debris. Do not hose down the area to the storm drainage system. • Clean up vehicle and equipment fluid drips and spills immediately. • Place drip pans below inoperative or leaking vehicles and equipment, including employee vehicles. • Collect and discharge wash water to a sanitary sewer or haul for offsite disposal if washing/pressure washing of the parking lot occurs. There are businesses that will clean parking lots and collect water for off–site disposal. Never drain wash water to the storm drainage system. • Follow basic sediment controls as outlined in Appendix D (“Erosion and Sediment Control Standards”) of the King County Surface Water Design Manual for gravel and dirt lots. These types of parking lots may require additional BMPs to prevent sediment laden water from leaving your site. Supplemental BMPs: • Encourage employees to repair leaking personal vehicles. • Encourage employees to carpool or use public transit through incentives. • Encourage customers to use public transit by rewarding valid transit pass holders with discounts. • Install catch basin inserts to collect excess sediment and oil if necessary. Inspect and maintain catch basin inserts to ensure they are working correctly. Additional Information: • Disposal Information Sheet • Catch Basin Insert Information Sheet For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater. Stormwater Pollution Prevention Manual • King County64 A-32 Sidewalk Maintenance Best Management Practices (BMPs) are required by King County Code 9.12. If the BMPs included here are not enough to prevent contamination of stormwater, you will be required to take additional measures. Required BMPs: • Sweep sidewalks as needed to collect loose dirt and debris rather than blowing or pushing it into the street or gutter or hosing it down. Collected materials must be disposed of as solid waste. • Clean individual stains instead of washing the entire sidewalk if possible. • Collect wash water and dispose of into the sanitary sewer or take off site for appropriate disposal if soaps or other cleaners are used. If only water is used, install a catch basin insert or filter cloth in order to collect all solids and debris. • Use a minimum amount of sand or deicing salts and sweep up any remaining granules when the snow and ice have melted. Additional Information: • Disposal Information Sheet • Storage of Liquid Materials in Portable Containers – See Activity Sheet A-3 • Containment Information Sheet For more information or assistance contact the King County Stormwater Services at 206–477–4811 and visit kingcounty.gov/stormwater.