The URL can be used to link to this page

19-101975-PCCITY OF Federal Way 'entered on Opportunity June 10, 2019 Mr. Ben Hruska Broderick Architects 55 South Atlantic Street, Suite 301 Seattle, WA 98134 CITY HALL 33325 8th Avenue South Federal Way, WA 98003-6325 (253) 835-7000 www. cityoffederalway.. com Jim Ferrell, Mayor FILE Re: File #19-101975-PC, PREAPPLICATION CONFERENCE SUMMARY Christian Faith Center Gymnasium, 33645 20th Avenue South, Federal Way Dear Hruska: Thank you for participating in the preapplication conference with the City of Federal Way's Development Review Committee (DRC) held May 16, 2019. We hope that the information discussed at that meeting was helpful in understanding the general requirements for your project as submitted. This letter, summarizes comments given to you at the meeting by the members of the DRC. The members who reviewed your project and provided comments include staff from the city's Planning and Building Divisions, Public Works Department, and representatives from Lakehaven Water and Sewer District and South King Fire and Rescue. Some sections of the Federal W/ay Revised Code (FWRC) and relevant information handouts are enclosed with this letter. Please be advised, this letter does not represent all applicable codes. In preparing your formal application, please refer to the complete FWRC and other relevant codes for all additional requirements that may apply to your project. I, As Planner Natalie Kamieniecki, am the key contact for your project (I may be reached at 253-835- 2638, or tia alie.kamieniecki ci ffederalwa .c ni . For specific technical questions about your project, please contact the appropriate DRC representative as listed below. Otherwise, any general questions about the preapplication and permitting process can be referred to me. PROJECT DESCRIPTION The proposal is to construct a 15,107 square foot gymnasium and future class rooms associated with the Christian Faith Center Development Agreement. MAJOR ISSUES Outlined below is a summary of the major issues of your project based on the plans and information submitted for preapplication review. These issues can change due to modifications and revisions in the plans. The major issues section is only provided as a means to highlight critical requirements or issues. Please be sure to read the comments made by all departments in the following section of this letter. Mr. Ben Hruska Page 2 of 14 June 10, 2019 • Planning Division 1. The city and Christian Faith Center entered into a Development Agreement PA) on July 21, 2004. leThe DA governs development standards and mitigation requirements for the two -phased construcf.an-of a church, school, and associated improvements. • Public Works Development Services Division 1. Please see the comment section below. • Public Works Traffic Division 1. Tran portation Conczrrrency Management (FWRC 19.90) — A transportation concurrency permit with an application fee of ,$9,032.00 is required for the proposed project. 2. Frontage Improvements (FWRC 19.135.040) — Frontage improvements were constructed for the entire site, including the school. If the proposal meets the 25 percent threshold criteria, the applicant may be required to construct the improvement as identified in the FWRC 19.135.030. 3. Transportation ImpactAnalysis (FL4) — A TIA prepared by a licensed engineer in Washington is required to assess other significant project impacts and determine appropriate mitigation measures not identified in the concurrency analysis. The TIA shall also include trip generation to determine the number of trips generated by the development. Building Division 1. Please see the comment section below. 0 Lakehaven Water & Sewer 1. Please see the comment section below., • South King Fire and Rescue 1. Please see the comment section below. 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 3 of 14 June 10, 2019 DEPARTMENT COMMENTS Outlined below are the comments made by the representatives of each department present at the preapplication conference. Each section should be read thoroughly. If you have questions, please contact the representative listed for that section. COMMUNITY DEVELOPMENT — PLANNING DIVISION Natalie Kamieniecki, Associate Planner, 253-835-2638,'natalie.kamieniecld@cityoffederalway.com 1. Land Use Approval— The city and Christian Faith Center entered into a Development Agreement (DA) on July 21, 2004. The DA governs development standards and mitigation requirements for the two -phased construction of a church, school, and associated improvements. Per the DA, the proposed school is allowed outright unless the agreement is amended. No land use application is required for this project. 2. General Regulations —The DA establishes the following standards for the school building in DA Sec. 9.1: a. Setbacks: Front = 50 feet; Side and Rear 50 feet. b. Height: 40 feet above average building elevation, with up to 3 additional feet allowed for articulated cornices. c. Maximum Building Size: 101,526 square feet gross floor area. d. Maximum Enrollment in the School and Daycare (combined): 900 full time students. _ e. Parking: Minimum stalls = 1,406; Maximum stalls = 1,540. 3. Critically Sensitive Areas— According to the city's Critically Sensitive Areas Map, wetlands are present on the site. Wetland mitigation is addressed in the amended DA from 2007, based on a wetland study performed for a wetland intrusion application approved on April 23, 2004. 4. State Environmental Policy Act (SEPA) Environmental Review — Per Section 6 of the DA, "The project has been subject to detailed environmental review. A Final Environmental Impact Statement ("FEIS") was issued on March 3, 2004, and addenda were issued April 16, 2004, and May 21, 2004. Mitigation of significant adverse environmental impacts imposed under SEPA, through the City's SEPA regulations, is incorporated into the Agreement." Additional SEPA review is not required unless the project differs from the DA or conditions on the site have changed substantially. 5. Wetland Mitigation —Christian Faith Center shall comply with all conditions contained in Exhibit H to the DA (DA, 9.7). 6. Landscaping— Christian Faith Center shall provide a combination of existing and new native landscaping to accomplish Type III landscaping along all property lines, public rights -of -way, and access easements (DA, 9.1.3.1). 7. Recreation Areas— Exterior recreation and play areas shall be provided in a minimum amount of 27,026 square feet in the school yard, and a minimum 100,000 square feet in the recreation/sports field (DA, 9.1.5.4). 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 4of14 June 10, 2019 8. Community Design Guidelines — Review of the proposal under the city's design guidelines, FWRC Chapter 19.115, is required for the project as the DA does not specify design requirements. The principal applicable guidelines for the project are noted below. However, this does not necessarily include all applicable guidelines, and project designers must consult the guidelines in their,entirety in preparing an application. The application must include a written narrative identifying how the proposal complies with the applicable design guidelines, as detailed. o FWRC 19.115.060 Building Design — Refer to all sections of this chapter for building design standards. Key sections include: i. (1) General Criteria (c) ii. (2) Building facade modulation and screening options — (a), (b), and (c) All building facades are both longer than 60 feet and visible from either a right-of-way or residential use or zone and therefore, shall incorporate facade treatment according to this section. Subject facades shall incorporate at least two of the four options on each facade. Options intended to break up the mass of large buildings include: (a) facade modulation (a minimum of six feet in width by two feet in depth); (b) landscape screening; (c) canopy or arcade; and (d) pedestrian plaza. Building facades visible from rights -of -way should incorporate methods of articulation and accessory elements in the overall architectural design, for example display windows, window openings with visible trim material, vertical trellis, artwork, decorative masonry or metal patterns or grillwork, relief, material variations, etc. 9. Rooftop Mechanical Equipment— Per FWRC 19.110.070, vents and similar appurtenances that extend above the roofline must be surrounded by a solid sight -obscuring screen that is integrated into the architecture of the building and obscures the view of the appurtenances from adjacent streets and properties. Please provide screening details on the elevation drawings. 10. Fees— Please contact the Permit Center at 253-835-2607, or hermit.center@cit<,oFtederalway.com, to confirm application fees. Please note that the building permit process is subject to fees, procedures, and review timeframes. You can submit a building permit application any time. No clearing, grading, or filling actions may occur on site in advance of building or grading permit, or other approval processes as required by the city. PUBLIC WORKS — DEVELOPMENT SERVICES DIVISION Kevin Peterson, 253-835-2734, kevin.peterson@cityoffederalway.com Land Use Issues — Stormwater 1. Surface water runoff control and water quality treatment will be required per the 2016 King County Surface Water Design Manual (KCSWDM). This project meets the requirements for a Full Drainage Review. At the time of site plan submittal, a preliminary Technical Information Report (TIR), addressing the relevance of the project to the nine core and five special requirements of the KCSW/DM will be required. A Level 1 downstream analysis shall also be provided in the preliminary TIR. 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 5of14 June 10, 2019 2. The project lies within a conservation flow control area; thus, the applicant must design the flow control facility to meet these performance criteria. In addition to flow control facilities, Best Management Practices (BMP's) are required as outlined in the KCSWDM. 3. The project also lies within an Enhanced Basic Water Quality'Area. Water quality treatment shall be designed to meet the treatment criteria of the Enhanced Basic Water Quality Menu. Beside those water quality treatment systems identified in the KCSWDM, the city will accept those systems that have been approved for Enhanced Basic Treatment under the Washington State Department of Ecology (WADOE) General Use Level Designation (GULD) criteria. 4. In addition to the KCSWDM, our initial review suggests that FWRC 19.30.120, "Nonconforming Water Quality Improvements" applies to this site. Specifically, the following items are applicable: La. Redevelopment which involves the creation or addition of impervious surfaces having an area of 5,000 square feet or more; 1.b. Redevelopment which involves the construction or replacement of a building footprint or other structure having a surface area of 5,000 square feet or more, or which involves the expansion of a building footprint or other structure by 5,000 square feet of surface area or more; 1.c. Redevelopment which involves the repair or replacement of 5,000 square feet or more of an impervious surface, when such redevelopment is not part of a routine maintenance activity; Therefore, water quality treatment will be required for the entire (subject) site, including new and existing pollution generating impervious surfaces. Treatment options must be selected from the Enhanced Basic Water Quality Menu provided in the KCSWDM. 5. If infiltration is proposed, soil logs prepared by a licensed geotechnical engineer or septic designer must be provided to verify infiltration suitability. 6. Detention and water quality facilities for private commercial developments outside the City Center Core must be above ground (i.e. open pond). Underground facilities are allowed only with approval from the City of Federal Way Public Works Department. 7. Show the proposed location and dimensions of the detention and water quality facilities on the preliminary plans. 8. If more than one acre will be disturbed during construction, a National Pollutant Discharge Elimination System (NPDES) construction stormwater permit may be required. Information regarding this permit can be obtained from the Washington State Department of Ecology at 360-407-6048, or httpJl,,v-,vw ecV wa.gov1programs/,,vglstormwater/construction/index.html. Right -of -Way Improvements 1. Seethe Traffic Division comments from Senior Transportation Planning Engineer Sarady Long for traffic related items. 19-101975-00-PC Doc ID:79136 Mr. Ben Hruska Page 6of14 June 10, 2019 Building Permit Issues 1. Engineer plans are required for clearing, grading, road construction, and utility work. Plans must be reviewed and approved by the city. Engineering review fees are $$3,004.00 for the first 18 hours of review for commercial building permits, and ,$167.00 per hour for additional review time. A final TIR shall be prepared for the project and submitted with the engineering plans. Both the TIR and the plans will require the signature/seal of a professional engineer registered/licensed in the State of Washington. 2. The Federal. Way Public Works Development Standards Manual (including standard detail drawings, standard notes, and engineering checklists) is available to assist the applicant's engineer in preparing the plans and TIR on the city's website at http://www.cityoffederaiNva; .comlindex.asi2x?nid=171. Bonding is required for all street improvements and temporary erosion and sediment control measures associated with the project. The bond amount shall be 120 percent of the estimated costs of the improvements. An administrative fee deposit will need to accompany the bond to cover any possible legal fees in the event the bond must be called. Upon completion of the installation of the improvements, and final approval of the Public Works Inspector, the bond will be reduced to 30 percent of the original amount and held for a two-year maintenance period. 4. The developer will be responsible for the maintenance of all storm drainage facilities (including the detention and water quality facilities) and street systems during the two-year maintenance period. During that time, the Public Works Inspector will make periodic visits to the site to ensure the developer's compliance with the maintenance requirements. Upon satisfactory completion of the two-year maintenance period, the remainder of the bond will be released. Maintenance for public roads and subdivision drainage facilities then become the responsibility of the city. Maintenance for private roads and drainage facilities, including short plats, remain the responsibility of the individual property owners. f 5. When topographic survey information is shown on the plans, the vertical datum block shall include the phrase "DATUM: N'G.V.D.-29" or "DATUM: K.C.A.S.," on all sheets where vertical elevations are called out. 6. Drawings submitted for plan review shall be printed on 24" x 36" or 22" x 34" paper. Site plans shall be drawn at a scale of 1" = 20', or larger. Architectural scales are not permitted on engineering plans. 7. Provide cut and fill quantities on the clearing and grading plan. 8. Temporary Erosion and Sediment Control (TESC) measures, per Appendix D of the 2016 KCSWDM, must be shown on the engineering plans. 9. The site plan shall show the location of any existing and proposed utilities in the areas affected by construction. 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 7 of 14 June 10, 2019 PUBLIC WORKS — TRAFFIC DIVISION Sarady Long, 253-835-2743, sarady.long@cityofl'edtralway.com Transportation Concurrency Analysis (FWRC 19.90) 1. Based on the submitted materials for 15,107 square foot gymnasium building for on -site school, the Institute of Transportation Engineers (ITE) Trip Generation — 1011, Edition, land use code 536 (Private School — K-12), the proposed project is estimate to generate 83 weekday PM peak hour trips (staff estimate base on ITE LUC 530). 2. A concurrency permit is required for this development project. The PW Traffic Division will perform a concurrency analysis to determine if adequate roadway capacity exists during the weekday PM peak period to accommodate the proposed development. Please note that supplemental transportation analysis and concurrency mitigation may be required if the proposed project creates an impact not anticipated in the six -year Transportation Improvement Plan (TIP). 3. The estimated fee for the concurrency permit application is ,$'9,032.00 (51 — 500 trips). This fee is an estimate and based on the materials submitted for the preapplication meeting. The concurrency applicant fee must be paid in full at the time the concurrency permit application is submitted with the land use application. The fee may change based on the new weekday PM peak hour trips as identified in the concurrency trip generation. The applicant has the option of having an independent traffic engineer prepare the concurrency analysis consistent with city procedures; however, the fee remains the same. Transportation Impact Fees (TIF) (FWRC 19.91) 1. As part of the site development, it appears that the identified pro-rata share mitigation was paid for the entire site, including the proposed school building. However, additional trips above those assumed to be generated by the school would be subject to the applicable traffic impact fees. Transportation Impact Analysis (TIA) (FWRC 19.135) A transportation analysis was performed for the entire site over 14 years ago. The City cannot support using this outdated transportation analysis for the proposed school gymnasium, due to changes in the exiting condition. Furthermore, the school portion of the property was not developed within the specified period per the phasing requirements of the agreement. Therefore, a Transportation Impact Analyses (TIA) to identify transportation impacts of development projects and provide appropriate mitigation measures is required. 2. A Traffic Impact Analysis (TLA) prepared by engineer licensed in the state of Washington is required for this development project. The engineer should contact the Traffic Division for a scoping sheet in the initial stages of their study. The TIA should include the following analysis: EL A specialized land use trip generation study for the proposed private school. ■ Neighborhood traffic impact analysis along 20th Avenue South to determine traffic impacts and potential measures to enhance or eliminate movement restrictions at intersection of South 336th Street and 201h Avenue South. • School bus traffic circulation at the site and queuing at the driveway. 19-101975-00-PC Doc ID:79136 Mr. Ben Hruska Page 8of14 June 10, 2019 Street Frontage Improvements (FWRC 19.135) Based on King County Assessor's records and the submitted materials, it appears that this proposal will not meet the 25 percent threshold criteria for requiring street frontage improvements as identified in FWRC 19.135.030. The applicant/owner should submit an appraisal for the subject property along with the actual estimated value of the proposed project to the Public Works Development Services Division. The division will evaluate the submitted appraisal data to determine if the project actually meets or does not meet the city's 25 percent threshold for requiring street frontage improvements on South 3361h Street and 20th Avenue South. Access Management (FWRC 19.135) Access management standards are based on roadway safety and capacity requirements. FWRC 19.135.280 provides access standards for streets based on planned roadway cross -sections. Please note that access classifications are per Drawing 3-1A in the Public Works Development Standards. 2. For driveways that serve uses other than single-family residential uses and zero lot line townhouse developments, the maximum driveway width is 30 feet for a two-lane two-way driveway and 40 feet for a three -lane two-way driveway (FWRC 19.135.270). Driveway widths may be increased in order to provide adequate width for vehicles that may be reasonably expected to use the driveway, as determined by the Public Works Director. PUBLIC WORKS — SOLID WASTE AND RECYCLING DIVISION Rob Van Orsow, 253-835-2770, robv@cityoffederalway.com Solid Waste & Recycling Design Considerations • Adequate space allocation for interior and exterior garbage, recycling, food waste, waste oil, yard debris, hazardous waste, or biohazard collection containers. Minimum recycling space allocation is established by FWRC 19.125.150. ■ For basic solid waste and recycling needs within a single enclosure, clear interior dimensions measuring 10 feet deep by 20 feet across are recommended, along with a two -door swing -open or roll -open gate that spans the front width of the enclosure. When gate doors are opened, no structure or hardware should remain above grade across the enclosure opening. Gate pins/holes are preferred for holding gates in closed and open positions to ease service access and maximize the life of gate hardware. + Sites may require a larger enclosure, or multiple enclosures, to accommodate on -site user access and/or additional waste types and containers. 0 Plan for user access to interior waste and recycling storage areas/containers, and to exterior containers screened by enclosure(s). ■ Plan for unobstructed, safe enclosure ingress and egress for service vehicles, directly in line with enclosure openings. Allow appropriate turning radii for service vehicles, and minimize potential "blind spots" during ingress and egress. 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 9 of 14 June 10, 2019 • Consider landscaping, setbacks and screening requirements (based on FWRC 19.125.040[41 & [51). • Note that larger -scale commercial or multi -unit housing developments may see long-term savings from the use of on -site waste compaction equipment. Planning for this equipment may require larger enclosure dimensions, defined overhead clearances, consideration of power utility access, and drainage management. ■ Mixed -use developments may also benefit from on -site waste compaction equipment. Additional mixed - use development considerations include: o Designated chutes and/or internal facility maintenance areas or services for tenants; o Moving waste and recycling streams from interior units to collection areas; and o Access by business tenants and/or residents to exterior waste and recycling areas. Help with many design parameters related to service access is available via the city's contracted solid waste services provider, Waste Management. Contact Senior Route Manager John Davis at 206-786-4530 (cell). COMMUNITY DEVELOPMENT — BUILDING DIVISION Greg Kirk, Plans Examiner, 253-835-2621, greg.kirk@cityoffederalway.com 1. Building Codes. The structure will be treated as a new building permit application and must meet all current codes including: • International Building Code (IBC), 2015 Washington State Amendments WAC 51-50 ■ International Mechanical Code (IMC), 2015 Washington State Amendments WAC 51-52 Uniform Plumbing Code (UPC), 2015 Washington State Amendments WAC 51- 56 & WAC 51-57 • International Fire Code (IFC), 2015 Washington State Amendments WAC 51 -54 • National Electric Code (NEC), 2014 • Accessibility Code (ICC/ANSI Al17.1), 2009 • International Residential Code, 2015 Washington State Amendments WAC 51-51 • Washington State Energy Code, 2015 WAC 51-11 2. Building Criteria. The following applies to the proposed structure: ■ Occupancy Classification: A-3 • Type of Construction: VB ■ Floor Area: 15,707 0 Fire Protection: Sprinklered • Number of Stories: One, but must be designed to support future second floor (school) • Wind/Seismic: Basic wind speed 85 Mph, Exposure `B", 25# Snow load, Seismic Zone D-1 19-101975-00-PC Doc ID:79135 Mr. Ben Hruska Page 10of14 June 10, 2019 3. Building Permit Application Process. A completed building permit application and commercial checklist are required. The commercial checklist will be completed by staff and provided at the time of the land use approval. Copies of application and checklist may be obtained at,,vww.citvoffederalwa .c in. Appointments are required for intake of new commercial building permit submittals. Please contact our Permit Center to schedule an intake appointment 253-835-2607, or tc nt ci offederal�,va .cam. Some projects may require a third party review or inspection. The cost to cover these fees is the responsibility of the applicant. Any third party fee is in addition to regular permit fees and costs. Please note, land use approval is recommended prior to submitting the building permit application to avoid delay in project review. If the project has not received land use approval, it may be placed on hold until land use review is completed. 4. Review Timing. Federal Way reviews plans on a first in, first out basis; however, there are some small projects with inconsequential review requirements that may be reviewed out of order. The first comment letter can be expected within five to seven weeks of submittal date. Re -check of plans will occur in one to three weeks after re -submittal. Revised or resubmitted plans shall be provided in the same format, size, and amount as the originally submitted plans. Revised/resubmitted drawings shall indicate by means of clouding or written response, what changes have been made from the original drawings. Plans for all involved departments will be forwarded from the Community Development Department. 5. Other Permits &Inspections. Separate permits maybe required for electrical, mechanical, plumbing, fire suppression systems, and signs. Applicants may apply for separate permits at any time prior to commencement of construction. When required, special inspections shall be performed by WABO approved agencies or by agencies approved by the building official prior to permit issuance. Construction must be approved by all reviewing departments prior to final building division inspection. All concerned departments (planning, public works, electrical, & fire) must sign off before the Building Division can final the structure for occupancy. Building final must be approved prior to the issuance of a Certificate of Occupancy. Construction projects may be required to have a pre -construction conference. If a pre -con meeting is required, the general or representative, all subs, the architect or representative, the engineer or representative, electrical contractor, and any other interested party, should attend this meeting. Meetings will occur at the Building Division and will be scheduled by the inspector of record for the project. The information provided is based on limited plans and information. The comments provided are not intended to be a complete plan review and further comments are possible at time of building permit plan review. 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 11 of 14 June 10, 2019 LAKEHAVEN WATER AND SEWER DISTRICT Brian Asbury, 253-946-5407, BAsbury@lakehaven.org Water A Water Certificate of Availability issued separately by Lakehaven may be required to be submitted with any land use and/or building permit application (check with land use agency for requirement). A certificate is valid for one year from date of issuance. If a certificate is needed, allow one to two working days to issue for typical processing. The 2019 cost for a Water Certificate of Availability is $70.00. Hydraulic model results (FF #171, enclosed) indicate that Lakehaven's standard maximum allowable system liquid velocity of 10 ft/s, at no less than 20 psi, is exceeded at a fire flow rate above 4,200 GPM. This flow figure depicts the calculated performance of the existing water distribution system under high demand conditions. Fire flow rates greater than available in the existing distribution system may be accommodated through water distribution system improvements. Onsite hydraulic system calculations may need to be determined during design of the onsite water distribution system improvements. Please contact Lakehaven for further detail. • The site has an existing two inch irrigation water service connection/meter (SvcNo. 34859). The site also has an existing four -inch domestic water service connection stub and a six-inch fire -protection service connection stub. A water service connection application submitted separately to Lakehaven is required for each new service connection to the water distribution system, or any modification to an existing water service connection (e.g., larger meter/service, etc.), in accordance with standards defined in Lakehaven's current "Fees and Charges Resolution." Non -single-family properties require separate domestic (per building, typically, some exceptions allowed), irrigation (if irrigated landscaped areas are incorporated into the site development), and fire protection (if required or installed) water service connections and meters. To satisfy premise isolation requirements, the installation and satisfactory testing of an approved backflow prevention assembly (BPA) adjacent to each domestic, irrigation and fire -protection service meter is required pursuant to WAC 246-290-490 and Lakehaven standards regarding premise isolation. For domestic and irrigation, as low health cross -connection hazards, either a double check valve assembly (DCVA) or a reduced pressure backflow assembly (RPBA) is required. For fire -protection, and presuming no system fixtures more than 30 feet above ground level, an aboveground double check detector assembly (DCDA) or an aboveground reduced pressure detector assembly (RPDA) is required for three-inch and larger fire protection service connections. Contact Lakehaven's Cross -Connection Control Program Manager (Chris Zoepfl, CZoe fl Lakehaveno , 253-946-5427) for additional information on premise isolation/BPA installation and testing coordination. • Based on the proposal submitted, preliminary estimated Lakehaven water service connection fees, charges, and/or deposits (2019 schedule) will be as follows. Actual connection charges will be determined upon submittal of service connection application(s) to Lakehaven. All Lakehaven fees, charges, and deposits are typically reviewed and adjusted (if necessary) annually, and are subject to change without notice. o Water Service/Meter Installation -Domestic, 2" preliminary size: $5,770.00 deposit. Actual size to be determined by Lakehaven based on applicant's estimated maximum GPM usage rate. 19-101975-00-PC Doc 10:79138 Mr. Ben Hruska Page 12 of 14 June 10, 2019 o Water Meter Installation -Fire -Protection: $474.10 charge. o Capital Facilities Charge(s)-Water: $12,726.36 (estimated 3.00 new ERU). Actual amount due to be determined by Lakehaven based on applicant's estimated annual total water usage rate. Water system capacity credits are available for this property from system capacity charges previously assessed, paid directly to Lakehaven, and/or credited to the property for 6.00 Equivalent Residential Units (ERU). Please contact Lakehaven for further detail. Sewer • A Sewer Certificate of Availability issued separately by Lakehaven may be required to be submitted with any land use and/or building permit application (check with land use agency for requirement). The certificate is valid for one year from the date of issuance. If a certificate is needed, allow one to two working days to issue for typical processing. The 2019 cost for a Sewer Certificate of Availability is $70.00. A separate Lakehaven Sewer Service Connection Permit is required for each new connection to the sanitary sewer system, in accordance with standards defined in Lakehaven's current "Fees and Charges Resolution." Minimum pipe slope for gravity sewer service connections is two percent. In addition to all other sewer service installation standards, installation of a Type 1, 48-inch monitoring manhole is typically required on the private building sewer line, for all new or modified non-residential connections. Also, installation of an externally -located grease interceptor is required for all new restaurants and/or buildings with food preparation/service establishments, size to be determined by applicant's engineer. Also, if applicable, see the enclosed Lakehaven Trash/Recycling Enclosure Standards. ■ Based on the proposal submitted, preliminary estimated Lakehaven water service connection fees, charges, and/or deposits (2019 schedule) will be as follows. Actual connection charges will be determined upon submittal of service connection application(s) to Lakehaven. All Lakehaven fees, charges, and deposits are typically reviewed and adjusted (if necessary) annually, and are subject to change without notice. o Sewer Service Connection Pem-it: $420.23 charge. o Capital Facilities Charge(s)-Sewer: $0.00. Actual amount due to be determined by Lakehaven based on applicant's estimated annual total domestic water usage rate. Sewer system capacity credits are available for this property from system capacity charges previously assessed, paid directly to Lakehaven, and/or credited to the property for 81.88 ERU. Please contact Lakehaven for further detail. General All Lakehaven development engineering related application forms, and associated standards information, can be accessed at Lakehaven's web pages: hr �v v.lakehaven. r 2 Develo meat -En 'ne rim . All comments herein are valid for one year and are based on the proposal(s) submitted and Lakehaven's current regulations and policies. Any change to either the development proposal(s) or Lakehaven's regulations and policies may affect the above comments accordingly. 19-101975-00-PC Doc ID:79138 Mr. Ben Hruska Page 13 of 14 June 10, 2019 SOUTH KING FIRE AND RESCUE Chris Cahan, 253-946-7243, Chris Cahan@southidngfire.org Water Supply Fire Flow The required fire flow for Phase I is 1625 gallons per minute. For future planning, the fire flow for both Phase I and Phase II is 2500 gallons per minute. A Certificate of WlaterAvailability including a hydraulic fzre floav model shall be requested from the water district and provided at the time of the building permit application. Fire Hydrants Existing fire hydrants on the site meet the requirements for this project. Hydrant spacing along access roads and location in relationship to buildings and sprinkler FDC shall be approved by the Fire Marshal's Office. Fire hydrants shall be in service prior to and during the time of construction. Emergency Access Fire apparatus access roads shall comply with all requirements of Fire Access Policy 10.006: southkin Esr .org/DocumentCenter/F4ome/Viewl24 Designated and marked fire lanes may be required for emergency access. This may be done during the plans check or prior to the building final. Requirements and marking options can be found in Title 8 of the FWRC: lit -,vww. o e ubhslun .com l lA FedeL,alWav . Fire apparatus access roads shall be installed and made serviceable prior to and during the time of construction. Vehicle Access Gates All vehicle access gates shall comply with the gate policy: ht22://soutl-tkingfLre.org/DocLiment(-,enter/Home/Viekv/21. Fire Department Lock Box A mcessed fire department "Knox" brand key box shall be installed on the building near the front entrance. Location(s) will be approved by the plan reviewer or Deputy Fire Marshal onsite. Fire Sprinkler System An NFPA 13 fire sprinkler system is required. Fire Alarm A fire alarm system is required. Fire Suppression System An approved Eire suppression system is required for all type 1 kitchen hoods. This is in reference to the proposed cafe. Exiting Provide an Assembly Main Exit (2015 IFC 1029.2). Provide a main exit sized to accommodate'/z the total occupant load of the gymnasium. 19-10197T-00-PC Doc ID:79136 Mr. Ben Hruska Page 14 of 14 June 10, 2019 CLOSING This letter reflects the information provided at the preapplication meeting and is intended to assist you in preparing plans and materials for formal application. We hope you found the comments useful to your project. We have made every effort to identify major issues to eliminate surprises during the city's review of the formal application. The completion of the preapplication process in the content of this letter does not vest any future project application. Continents in this letter are only valid for one year as per FWRC 19.40.070(4). As you know, this is a preliminary review only and does not take the place of the full review that will follow submission of a formal application. Comments provided in this letter are based on preapplication materials submitted. Modifications and revisions to the project as presented for this preapplication may influence and modify information regarding development requirements outlined above. In addition to this preapplication letter, please examine the complete FWRC and other relevant codes carefully. Requirements that are found in the codes that are not addressed in this letter are still required for your project. If you have questions about an individual comment, please contact the appropriate department representative noted above. Any general questions can be directed towards me, the key project contact, Natalie Kamieniecki, at 253-835-2638, or nat-ahe.k,.imieniecki0cityoffederalNvay.com. We look forward to working with you. Sincerely, &4- AL,� Natalie Kamieniecki Associate Planner enc: Lakehaven Handouts c: Kevin Peterson, Development Services Sarady Long, Traffic Division Greg Kirk, Building Plans Examiner Brian Ashbury, Lakehaven Water and Sewer District Chris Cahan, South King Fire and Rescue 19-101975-00-PC Doc ID:79138 CITY OF Federal Way May 16, 2019 10:00 a.m. Pre -application Conference Sign in Sheet COMMUNITY DEVELOPMENT REVIEW COMMITTEE Project Name: Christian Faith Gymnasium and School Address: 33645 201h Ave S File Number: 19-101975-PC City Hall Hylebos Room NAME DEPARTMENT / DIVISION TELEPHONE NUMBER/EMAIL Natalie Kamieniecki Community Development 253-835-2638 1. Associate Planner c3�ao ►ccx p�c�-k�-CS natalie.kamieniecki@cityoffederalway.com � ! ►� �7�fLrcLC zvr • 'F3Z 3. �LSD'� NIE-c_c�QC LP�14f1+AVE-N, 5. I, DP ai �crlter�� w 6. S j-� l �(/ v�"/ De /�� c . 5 rid �. priJ C��•2Y.'s/ c �a ?� l.v�� vl \ iv. ? 1�►, Ica 7. -ZS3 -?3'T- 2-13A 8. 1 P i�e.114� \• w ( L)` eau. �I't S J�1 a�3 - �335-a-73 0 9. Cl� iu D�J ,J� cr�3 1�.��:� •� 10. 11. 12. G (ElApt. LAKEHAVEN UTILITY DISTRICT Hydraulic Model Fire Flow Estimate Request/Reporting Form Requested By: Brian Asbury for Abbey Road Group LLC Date: 03/11/03 Hydrant Location: �/, Section K-11 Intersection: So. 339 St. & 20th Ave. So. Additional Description: see attached map Results By: Date: Model Run No.: Bert Ross l 03/31/03 95LUDSFF.INP FF#171 Condition Pressure (psi) Flow (gpm) Static 57 0 Fire Flow 2 0 5,300 NOTE: The fire flow analysis was performed at the proposed on -site intersection of water mains at approximately South 339th Street and 20th Avenue South. The complete water system for the project was entered into the hydraulic model, consisting of approximately 6,600 feet of pipeline as shown on the Civil Master Plan for the Christian Faith Center dated May 28, 2002 and prepared by AHBL (including the "loops" around the School Auditorium/Sanctuary Building and the School Building). Connections to the existing water system were assumed to be made at the following locations: • South 336th Street & 20th Avenue South • South 339th Street & Pacific Highway South • South 340th Street & 19th Avenue South • South 341st Place & 20th Place South The size of the entire proposed pipeline system was assumed to be 8-inch diameter. On -site fire flow estimates would have to be determined during design of the water system improvements. The fire flow shown in the table above will cause velocities in excess of 10 fps within certain segments of the proposed on -site water pipeline system, but not exceed this threshold velocity within the existing adjacent and nearby water system. A fire flow rate less than 4,200 gpm (@ 31.70 psi residual pressure) will maintain flow velocities below 10 fps. By District policy, a maximum fire flow rate of 2,500 gpm is available. Page 1 of 2 Koo It There is no guarantee that the Hydraulic Model results will represent actual system performance. Model results depict the theoretical performance of the system under high demand conditions. Field measurements should always be obtained for design purposes. Page 2 of 2 l take�IV haven Dx �" C 12" AC 2121tEFWti � o C Ex. 8" Sewer W 8„ Svc Stub 8" DI 8'. Dx8 n (approx.) l 2121049003 ' 8" UI g„ D C 13 Ex. Irrigation , 2" Wtr Svc tV ti= O v 0 Cn 2121049004 is 33645 0 CO o" S., v 8„ DI+ 00 0 0 t.l G 4 os R) $„ Dx x x WEY REP T oo 2121049082 O 2121049061 ' 21210490$ 2121049 2 1924 q 2102 2110 2835, NOTE: Lakehaven Water and Sewer Christian Faith Center Gymnasium ~ District neither warrants nor guarantees 19-101975-00-PC the accuracy of any facility information 0 200 400 provided. Facility locations and conditions are subject to field verification. Feet 5/14/2019 BIA CITY OF ti. Federal Way Centered on Opportunity May 1, 2019 Mr. Ben Hruska Broderick Architects 55 South Atlantic Street, Suite 301 Seattle, WA 98134 ben@brocieriekarchitects.com CI-TY HALL 33325 8th Avenue South Federal Way, WA 98003-6325 (253) 835-7000 www.cityoffederalway.com FILE Re: File #19-101975-PC; PREAPPLICATION CONFERENCE Christian Faith Center — Gymnasium, 33645 20th Avenue South, Federal Way Dear Mr. Hruska: Jim Ferrell, Mayor The Community Development Department is in receipt of your preapplication conference request. The application has been routed to members of the Development Review Committee and a meeting with the project applicant has been scheduled as follows: 10:00 a.m. — Thursday, May 16, 2019 Hylebos Conference Room Federal Way City Hall, 2-d Floor 33325 8dt Avenue South Federal Way, WA 98003 We look forward to meeting with you. Please coordinate directly with anyone else you would like to attend the meeting as this will be the only notice sent by the department. If you have any questions regarding the meeting, please contact me at nat-,the.kmiienieckigcityaffederahvap corn, or 253-835-2638. Sincerely, Natalie Kamieniecki Associate Planner 19-10I975-00-PC Doc. I.U. 79089 CITY OF FEDERAL WAY COMMUNITY DEVELOPMENT DEPARTMENT DEVELOPMENT REVIEW COMMITTEE TRANSMITTAL DATE: April 30, 2019 TO: Cole Elliott, Development Services Manager Greg Kirk, Building Plans Examiner Rick Perez, City Traffic Engineer Brian Asbury, Lakehaven Water & Sewer District Chris Cahan, South King Fire & Rescue FROM: Nlatali.e Kamieniecki, Associate Planner FOR DRC MTG. ON: Internal - May 9, 2019 Meeting with applicant - May 16, 2019; 10:00am FILE NUMBER(s): 19-101975-00-PC RELATED FILE NOS.: Christian Faith Center Development Agreement PROJECT NAME: CHRISTIAN FAITH CENTER - GYMNASIUM PROJECT ADDRESS: 33645 20TH AVE S ZONING DISTRICT: RM 3600 PROJECT DESCRIPTION: Construct new 15,107 square foot gymnasium. LAND USE PERMITS: PROJECT CONTACT: BEN HRUSKA BRODERICK ARCHITECTS MATERIALS SUBMITTED: Master Land Use Application Project Narrative Vicinity Map Gymnasium Building Plan Set q~ CEI VE:,_ MASTER LAND USE APPLICATION DEPARTMENT OF COMMUNITY DEVELOPMENT APR 2 5 2019 33325 8`h Avenue South CITY OF OF FED Federal Way, WA 98003-6325 �MMUNf Ty'DEVE OPXf 253-835-2607; Fax 253-835-2609 Federal w►v.y.cityoffederal►vay.coin APPLICATION NO(s) _'9 Il.dl " 5 — ■ � Date -/ _z91S, Project Name CHRISTIAN FAITH GYMNASIUM Property Address/Location 33645 20th Ave S Federal Way, WA 98003 Parcel Number(s) 212104-9003 Project Description New 15,707 sf Gymnasium Building. The gym will provide seating for approximately 528 seats. Additional spaces within the project scope include: Kitchen and Hub multi -use space sized for future school, locker rooms for home and away teams, restrooms, and a multipurpose room. The building 1'li..EASL PRINT will likely be the first phase of a future school project. Type of Permit Required Annexation Binding Site Plan Boundary Line Adjustment Comp Plan/Rezone Land Surface Modification Lot Line Elimination X Preapplication Conference Process I (Director's Approval) Process II (Site Plan Review) Process III (Project Approval) Process IV (Hearing Examiner's Decision) Process V (Quasi -Judicial Rezone) Process VI SEPA w/Project SEPA Only Shoreline: Variance/Conditional Use Short Subdivision Subdivision Variance: Commercial/Residential Required Information RM 3500 + Ord #04-461 Zoning Designation Multi -Family Comprehensive Plan Designation Value of Existing Improvements 2.4 M Value of Proposed Improvements International Building Code (IBC): A-3 Occupancy Type VB Construction Type Applicant Name: Ben Hruska Address: 55 S Atlantic St #301 City/State: Seattle, WA Zip: 98134 Phone: (206) 682-7525 Fax: (206) 682-7529 Email: ben@broderickarchitects.com Signature: Agent (if different than Applicant] Name: Address: City/State: Zip: Phone: Fax: Email: Signature: Owner Name: Rick Weisz Address: 33645 20th Ave S City/State: Federal Way, WA Zip: 98003 Phone: Fax: Email: Signature: Bulletin #003 —January 1, 2011 Page 1 of 1 k:\Handouts\Master Land Use Application r r rBRODERICK ARCHITECTS 55 S. ATLANTIC STREET, SUITE 0301 SEATTLE, WA 98134 206.682.7525 SR18 _ Ija EE yI� rwN. C-,:::: fi VICINITY MAP N.T.S. �I RECEIVED APR Z 5 2019 co UOFF NrfY DEV 0 MENT ADDRESS OF PROPERTY 33652 20TH AVE S OWNER: RICK WEISZ CHRISTIAN FAITH CENTER LEGAL DESCRIPTION: PARCEL B LESS POR FOR RDS OF FEDERAL WAY BLA #04-102593-OOSU REC #20041014900006 SD BLA SITUATED IN NW 21-21-4 LY S OF S 336TH ST & W OF SR 5 - PORTION TAXABLE ASSESSOR PARCEL NO: 212104-9003 ■ BRODERICK ARCHITECTS 4/25//2019 City of Federal Way — Community Development Department 33325 8`h Ave S Federal Way, WA 98003-6325 RE: Pre -Application Conference Address: 33652 201h Ave S Parcel #: 2121049003 Project Name: Gymnasium Building at Christian Faith Church RECEIVED APR 2 5 2019 CITY OF FEDERAL WAY COMMUNITY OEveLopM i On behalf of Christian Faith Church and at the recommendation of Doc Hansen, we're submitting preliminary drawings for a Pre -Application Conference. This project is a smaller version of a project submitted for a Pre -Application Conference in January of 2018. Project Narrative: This proposal is for a new gymnasium building on the Christian Faith campus. This building is proposed as the first phase of a future school. This building was originally proposed as part of the 2004 development agreement and adopted with ord. #04-461. The original building was approved at 101,526 sf and is now only 15,707 sf. A possible future expansion will expand the gym into a school and would be 2 stories and approximately 33,983sf when complete. As currently proposed, the gymnasium will be used by members of the church. The design attempts, to the maximum extent possible, maintains consistencies with the plans from the original development agreement. The awning at the front of the building is a new design element that will provide some protection from the elements for the elements and would be retained in future phases. It's columns to match the church building across the street. To further maintain architectural consistency with the church, cement fiber panels and reveals will be painted to match the brown panels there. The variations in the siding on the exterior were intended to add visual interest, help bring down the scale the building massing and give a sense of base and cap elements. Mechanical equipment will be located on the north side of the building on a lower roof behind screen walls that match the building finishes. Landscaping screening will be added around the building perimeter. 55 South Atlantic Street, Suite 301 • Seattle, WA 98134 • (206) 682.7525 The site including existing parking and landscaping will largely remain unchanged except for the area immediately around the building. The building is being located within the area originally designated but moved south so as to maximize the playfield area while also allowing for the future school expansion. The drive to the north of the building and an installed transformer will be relocated to a new location. Excess soils from re -grading the proposed building location will be used to the maximum extent possible to expand the existing playfield area. Attached are the following items: • (1) Master Land Use • Check for $538.00 • (8) copies the Project Narrative (this letter) • (8) copies of a vicinity map • (8) copies of drawings, folded to 9 x12 Sincerely, V] ruskaY Project Manager 55 South Atlantic Street, Suite 301 • Seattle, WA 98134 • (206) 682.7525 1 ALL GENERAL NOTES GIVEN HEREIN APPLY TO ALL ALLIED TRADES FOR THE PROJECT AMENDED 2 ELSEWHERE TO INCLUDE ISOLATED CONDITIONS THE DRAWINGSINTENDED SHOW THEGEY RENOTI NEEMENTOBESNANDEXTENTOF GENERE ME T,D DESIGN GYMNASIUM BUILDING WORKANDARE NRRNTE SCALED THEW DIAGRA ARE PARTLY DIAGRAMMATIC 3 ALL DETAILS AND SECTIONS SHOWN ON THE DRAWINGS ARE INTENDED TO BE TYPICAL AND SHALL BE CONSTRUED TO APPLY TO ANY SIMILAR SITUATION ELSEWHERE ON THE PROJECT, EXCEPT CHRISTIAN FAITH CHURCH WHERE A DIFFERENT DETAIL IS SHOWN AT 4 THE CONTRACTOR ANDALL SUBCONTRACTORS SHALL VERIFY ALL GRADES, LINES, LEVELS, CONDITIONS, AND DIMENSIONS AT THE JOB SITE AND AS SHOWN ON THE DRAWINGS THEYSHALL REPORTANY ERRORS OR INCONSISTENCIES IN THE ABOVE TO THE ARCHITECT BEFORE COMMENCING WORK 5 CTORAND RFORALLLIINES,ELEVATIONSANDMEASUREMENTSINCTORS SHALL OUTTHEIR WORK FROM REFERENCE 33652 20TH AVE S •FEDERAL WAY, WA 98003 POINTSAANDBERESPONSIB CONNECTION WITH THEIR OWN 6 PROTECTION A THE CONTRACTOR IS RESPONSIBLE AND SHALL COMPLY WITH THE REQUIREMENTS OF THE BUILDING CODE HAVING JURISDICTION ANDALL LOCAL,STATE, AND FEDERAL LAWS B PROVIDE ALL SHORINGAND BRACING AS REQUIRED FOR THE PROPER EXECUTION OFTHE WORK REMOVE WHEN WORK IS COMPLETED C PROVIDE AND MAINTAIN GUARD LIGHTS AND BARRICADES ATALL AREAS OF WORK ADJACENT TO PUBLIC WAYS OR PUBLIC SPACES D. ATALL TIMES PROVIDE PROTECTION AGAINSTWEATHER (RAIN, WI ND, STORMS,ORHEAT)50 AS TO MAINTAIN ALL WORK, MATERIALS, APPARATUS AND FIXTURES FREE FROM DAMAGES. E THE CON TRACTOR SHALL PAY FOR ALL DAMAGES TO ADJACENT STRUCTURES, SIDEWALKS AND TO STREETS OR OTHER PUBLIC PROPERTY OR TO ANY PUBLIC UTILITIES T CONTRACTOR AGREES THAT HE WILL HOLD THE OWNER, ARCHITECT ANDIOR ANY OF THEIR EMPLOYEES OR AGENTS HARMLESS FROM ANY ANDALL DAMAGE CLAIMS WHICH MAY ARISE BY REASON OF ANY NEGLIGENCE ON PART OF THE CONTRACTOR, ANY OF HIS SUBCONTRACTORS ANDOR SUBCONTRACTOR'S MATERIALS AND EQUIPMENT SUPPLIERS AND/OR ANY OF THEIR EMPLOYEES OR AGENTS, IN PERFORMANCE OF THIS CONTRACT, AND IN CASE ANY ACTION IS BROUGHT BEFORE THEREOF AGAINSTTHE OWNER, ARCHITECT ANDIOR ANY OF THEIR EMPLOYEES OR AGENTS, CONTRACTOR SHALL ASSUME FULL RESPONSIBILITY FOR DEFENSE THEREOF, AND UPON HIS FAILURE TO DO SO ON PROPER NOTICE, OWNER, ARCHITECT ANDIOR ANY OF THEIR EMPLOYE ES OR AGENTSCONTRACT RESERVE THE RIGHT TO DEFEND SUCH ACTION AND CHARGE ALL COSTS THEREOEES CONTRACTOR ENERGY NOTES PLANNING NOTES PROJECT NOTES a IF ANY ERRORS OR OMISSIONS APPEAR IN THE DRAWINGS, SPECIFICATIONS OR OTHER DOCUMENTS, THE CONTRACTOR SHALL NOTIFY THE ARCHITECT IN WRITING OF SUCH OMISSIONS OR ERRORS PRIOR TO PROCEEDING WITH ANY WORK WHICH APPEARS IN QUESTION INTHE ENERGYCODE 2015 WSEC CKimmikLTAI JURISDICTION FEDERAL WAY PROJECT NAME GYMNASIUM BUILDINGATCHRIS7IAN FAITH CHURCH EVENT OF THE CONTRACTOR'S FAILING TO GIVE SUCH NOTICE, HE SHALL BE HELD RESPONSIBLE FOR THE RESULTS OF ANY SUCH ERRORS OR OMISSIONS AND THE COST OF RECTIFYING THE SAME. THE CONTRACTOR SHALL HAVE ALL ITEMS OR DETAILS CLARIFIED WITH THE ARCHITECT CLIMATE ZONE: MARINE4 ZONING RM-3500 WI SPECIAL GOND171ONS PER ORD 04461 PROJECTADDRESS 3365220TH AVES FEDERAL WAY. WA 9&003 PRIOR TO SUBMITTING A BID, OTHERWISE THE ARCHITECTS INTERPRETATION SHALL BE FINAL COMPLIANCE PATH: PRESCRIPTIVE FULLY CONDITIONED COMMERCIAL ADDITION(S) MINIMUM LOTAREA 831,533SF(KING CO RECORDS) INSULATION REQUIREMENTS PER R-VALUE METHOD PROJECT DESCRIPTION NEWGYMNASIUM BUILDING ON THE CHRISTAIN FAITHCAMPUS THIS 9 THE CONTRACTOR SHALL USE THE STRUCTURAL DRAWINGS TOGETHER WITH THE BUILDING IS PROPOSEDAS THE FIRST PHASE OFA FUTURE SCHOOL ARCHITECTURAL, MECHANICALAND ELECTRICAL DRAWINGS TO LOCATE DEPRESSED SLABS, SLOPES, ORAL NS, OUTLETS, RECESSES, OPENINGS, REGLETS, BOLTSETTING, SLEEVES, ADDITIONS NEW PORTIONS OF THE BUILDING ENVELOPE MUSTCOMPLY WITH THE THIS BUILDINGWAS ORIGINALLY PROPOSEDAS PARTOFTHE 2004 DIMENSIONS,ETC POTENTIAL CONFLICTS SHALL BE TRANSMITTED TO THE ARCHITECTBEFORE PROVISIONS THE THEY RE ATE CONSTRUCTION DEVELOPMENTAGREEMENTANDADOPTED WITH ORD 004461 THE PROCEEDING WITH THE WORK. WITHOUT REQUIRING THE UNALTERED PORTION TO COMPLY WITH THE [CURRENT) ORIGINAL BUILDING WAS APPROVED AT 101526 SF AND IS NOW ONLY 15.707 CODE SF. A POSSIBLE FUTURE EXPANSION WILL EXPANDTHE GYM INTO A SCHOOL 10, ALL WOOD WALL DIMENSIONS GIVEN ARE TO EXTERIOR FACE OF FRAMING LIGHT GA STEEL WALLS AND WOULD BE 2 STORIES ANDAPPROXIMATELY 33,983SFWHEN ARE DIMENSIONED TO CL OF FRAMING ALTERATIONS: EXPOSED FRAMING CAVITIES EXPOSED DURING CONSTRUCTION ARE TO BE COMPLETE AS CURRENTLY PROPOSED, THE GYMNASIUM WILL BE USED FILLED TO FULL DEPTH WITH INSULATION HAVING AMIN NOM VALUEOFR-3.0PER BY MEMBERS OF THE CHURCH 11. SOME CONNECTIONS INDICATED ON THE DRAWINGS ARE SCHEMATIC SECURE ALL COMPONENTS INCH RIGIDLY TO STRUCTURE AND EACH OTHER, USE FASTENERS DESIGNED FOR EACH INSERVICE THE DESCH ATTEMPTS, TOTIE MAXIMVid EXTENT Pp5.51BLE, W1VfYAH1$ CONNECTION INSULATION BUILDING NOTES AGREFYIENTETHEAWMNGA�NEFRONTOFT UILDMISANEW 12. OBTAIN CLARIFICATION AND INTERPRETATION OF DRAWINGS AND SPECIFICATIONS INCLUDE (MIN, R-VALUE) ROOF -ABOVE DECK R-3B ci 17ES1GN ElphIHi THAT WILL PROt70E 5451E PROTECTION FROM THE ADDITIONAL DETAIL, DIRECTLY FROM ARCHITECT AOCF 41EIALBLOG R-25. R-11 LS COMMERCIAL ELEA/PNTS FOR THE ELEIIENTSAHD WOULD BE RETAINED UN FUTURE NUMBEROFSTORIES 1STORY PHASES ITSCOLOMNSTOMATCHTTECHURCH ]WILDOiG AGR¢56THE 13. WASTE MATERIALAND RUBBISH FROM DEMOLITION AND ALTERATION OPERATIONS SHALL BE - STREET TO FURTFES2 MAIHTAIkpRC101FCTURALCON>V8IA WITH TFIE REMOVED FROM SITE AS RAPIDLY AS POSSIBLE AND SHALL NOT BE ALLOWED ACCUMULATE ON 1'lALLS•ME1AL 8iDG R-19 ci HEIGHT 35'TO ROOF QInNRC11.(EMENTflBER PANELSANOPE1kplSWILL BE PNHIEO TO MATCH HE D PREMISES DISPOSAL OFMATERIALSFOR TOR CONTRACTOR OPEN VJN.LS - STEEL FFGNED R-13. R40a THE BROWN PAN[{S T HBRE THE VARIATIORS IN DIE SIDING ON TIE OF WASTE. COOT ACOF BE PERMITTEDFORDI CONTRACTOR AN WOOD FRAMED &OTHER R-21 GROSS SF: .15701 CSFIPitOP05E04 MAL HELP EXTERIOR NOT TOTE, EXERIORA AREA DEMOLISHED BESAFEWALLS AREA SHALL BE EXTERIORAREATO NG THE TALLDEMOLISHEDNAN TO BE REUSED THIS BUSINESS AND UN -OBSTRUCTING THE BUILDING FUNCTION AND THE OWNER'S DAILY BUSINESS OPERATIONS -:r ; �, ^ = °--- -"'i= -- --_ 'n=- THE ILOiN MASSUN7ARDGIVE OF AND TYPE OF CONSTRUCTION VB THE SCAIF RF Bl11lDINGMA3301GAR0dVEASENEE OF BASEAHOCAP STEEL FRAME PRIMARY STRUCTURE WILIGHT GUAGE FRAMING ELEMENTS ILEDIUdNC.ALEQUIPMEN TWILLBELOCATE00NITHENORTH 14 EXISTING UTILITY LINES INDICATED OR NOTED ON THE DRAWINGS ARE SHOWN AS OBTAINED FROM ,-. ,�[ r F.: F [ SLOE DF THE Bk11L.No OH ALDWERROOF EIEH0N08CREFH WiLLLS 1HAT MATCH THE BUILDOG FINISHES 1AHOSCAFIHG SCREENING WILL SE ADDED EXISTING INFORMATION AND ARE PROBABLY INCOMPLETE AND ONLY APPROXIMATE IN LOCATION UTILITY FLOOR - STEEL JOISTS R-38.R-106 AROUNDTIE 011&110iG PF3tlNETER THE CONTRACTOR SHALL TAKE EXTREME CAUTION TO AVOID DAMAGE TO EXISTING LINES ANDIOR HARM TO PERSONNEL ENGAGED IN WORKING IN THE AREA UNHEATED SLAB R-10 PERIMETER EXTEND Z DOWNWARD OR HORIZONTALLY. NOT REO'D TO OCCUPANCY TYPE A3-ASSEMBLY THE SITE PAR WILL LARGELY 15. GLAZING TO BE INSULATED GLASS LABELED WITH NFRC CERTIFIED U-VALUE,AND MEETING THE EXTEND BELOW TOP OF FOOTING SPRINKLERS YES THE ARDLANDSIAELY REMAIN UNCHANGEDEXCEPT FOR THE AREAIMMEgATELY AROUND THE NGUNCHANGED EXSTINGCEPT REQUIREMENTS OF THE ENERGY CODE " -I' `' " "' D� �'-I ` E- i " BLDGAREASUMMARY EXIST NEW PROPOSED BUILDING THE BUILDING IS BEING LOCATEDWITHIN THE AREA ORIGINALLY DESIGNATED BUT MOVED SOUTH SO AS TO MAXIMIZE THE PLAYFIELD AREA Gf�iHIRFLOOR: I ALL CAVITIES IN THE THERMAL ENVELOPE SHALL BE FILLED WITH INSULATION, ,T7lALB0k0ING l y T� ; WHILE ALSO ALLOWING FOR THE FUTURE SCHOOLEXPANSON THEDRIVE ABBREVIATIONS INCLUDING CORNERS, HEADERS, RIM JOISTS, AND THE JUNCTION OF FOUNDATION TO SELL PLATE TO THE NORTH OF THE BUILDING ANDAN INSTALLEDTRANSFORMER WILL APPLICABLE CODES CITY OF FEDERAL WAY LAN DUSECODE:TITlE23 BE RELOCATED TO A NEW LOCATION. EXCESS SOILS FROM REGRADING FLOOR INSULATION SHALL BE INSTALLED IN PERMANENT CONTACT WITH 2O151NTERNATION BUILDING CODE WI WAAMENDMENTS THE PROPOSED BUILDING LOCATION WILL BE USED TO THE MAXIMUM AT FF FACE FLOOR PNL PANEL UNDERSIDE OF SUBFLOOR -AIR BARRIER SHALL BE INSTALLED ATANY EXPOSED 2015 WASHINGTON STATE ENERGY CODE EXTENT POSSIBLE TO EXPAND THE EXISTING PLAYFIELDAREA & AND FOC FACE OF CONCRETE PROP PROPERTY EDGE OF INSULATION 2015 INTERNATIONAL FIRE CODE ° DEGREE FOF FACE OF FINISH PT PRESSURE TREATED OWNER CHRISTIAN FAIAVETH CENTER B DIAMETER FGO FACE OF STUD PTD PAINTED EXTERIOR DOORS NOTE DOORS HAVING 50%OR MORE OPAQUE GLASS ARE CONSIDERED VERTICAL # POUNDS FTG FOOTING FENESTRATION FEDERAL W WA 90003 2539432400 FT FOOT OR FEET R RISER OR RADIUS SWINGINGDOORS U037 MAX URACTOR AB ANCHOR BOLT FURN FURNITURE RA RETURN AIR =.;--J-F'SD'i]C C°- c - %r�-, CONTACT: RICK WEISZ Rir1cW@dre0eniai0l us ABV ABOVE PAD RADIUS ACT ACOUSTICALTILE GA GAUGE OR GAGE RCP REFLECTED CEILING VERTICAL FENESTRATION TO COMPLY WITH DEFAULT PRESCRIPTIVE REQUIREMENTS, TOTAL BUILDINGS ARCHITECT BRODERICK ARCHITECTS AIE A ARCHITECT/ENGINEER GALV GALVANIZED PLAN ABOVE FINISH FLOOR VERTICAL FENESTRATION MUST BE 30%OR LESS OF GROSS ABOVE -GRADE WALL 55S ATLANTIC STREET,SUITE301 SEATTLE. WA 90139 LI ALUM GL GLASS GLB GLUE LAMINATED BEAM REINF REINFORCING ALTERN AREA 206682� ALT ALTERNATE GLZ GLAZING REDD REQUIRED T 2066027529(F) ANSI AMERICAN NATIONAL GYP GYPSUM RM ROOM MAX U.FACTORS , .:,,, F N:� c u, F , . . ARCH STANDARD INSTITUTE GWB GYPSUM WALLBOARD RO ROUGH OPENING ARCHITECT OR METAL FRAMED -FIXED WINDOW 036 MAX LUAtTDR METALFRAMED -OPERABLEWINDOW 040 MAX. U•FACTOR CONTACT BEN HRUSNA hen@hmdmickmchibcM mm ARCHITECTURAL HB HOSE BIB S SOUTH METAL FRAMED -ENTRANCE DOORS OW MAX U-FACTOR STRUCTURAL ENGINEER: RH2ENGINEERING HC HOLLOW CORE SA SUPPLY AIR 2272229TH DR BE#201 BD BOARD HDWD HARDWOOD Sc SOLID CORE SHGC: UNLESS SHADING ELEMENTS OR ROOF OVERHANGSARE PROVIDED, USE MAX BOTHEL,W BOTFELL, WA 9B027 BLK'G BLOCKING HDR HEADER SCHED SCHEDULE SHGC VALUE OF 064(WORST CASE) 4259515352 BM BM BUILDING HOW HARDWARE SO STORM DRAIN BEAM CONTACT. JON CONNER. PE, SE BTU BUR HF HEM -FIR SECT SECTION BRITISH THERMAL UNIT HGT HEIGHT SF SQUARE FEET BUILTUP ROOF WHERE SHADING IS PROVIDED, CALCULATE PF VALUE (PROJECTION FACTOR[ PER WINDOW AS FOLLOWS: CIVILENGINEER ENGINEERING HM HOLLOW METAL SIM SIMILAR pp_ -AJB, WHERE 'A' = HORIZ DIST FROM VERTICAL GLAZING TO FURTHEST 22 2272229TH DR BE, #201 HR HOUR SPEC SPECIFIEDOR EXTREMITY OF OF SHADING DEVICE AND 'B'=VERT. DIST. FROM BOTTOM OF BOTHELL. WA 90021 CB CATCH BASIN HW HOTWATER SPECIFICATION GLAZING TO UNDERSIDE OF SHADING DEVICE 4259515352 CJ CONSTRUCTION JOINT SST STAINLESS STEEL MAX SHGC IS THEN DETERMINED FROM TABLE BELOW CL CENTERLINE IBC INTERNATIONAL STC 30 N )TRANSMISSION CONTACT. JON CONNER, PE, SE CLG CLR CEILING CLEAR BUILDING CODE COEFFICIENT ORIENTATION ORIENTATION S��W N S.E. CMU CONCRETE MASONRY ID INSIDE DIAMETER STD STANDARD SHGC 0535HGC GENERAL CONTRACTOR: RYAN GENERAL CONTRACTORS LIC#RYANGC1930PC IFC INTERNATIONAL FIRE STL STEEL 0.2s PF<05 0.4B SHGC 0SB SHGC 14680 NE IN WOODINVILLE WAY#120 CO UNIT CODE STOR STORAGE CLEAN OUT IN INCHES STRUCT STRUCTURAL PF>0.5 064 SHGC 064 SHGC WOODINVILLE, WA 98D72 4254BB4489 COL COLUMN ININSULATION SUSP SUSPENDED CONE CONFERENCE INT INTERIOR SYS SYSTEM CONTACT DON MACINTOSH ftanbsh@Fyangc cam CONC CONCRETE IPC INTERNATIONAL SKYLIGHTS: SKYLIGHTS 050 MAX U-FACTOR CONT CONTINUOUS PLUMBINGCODE T TREAD DR TEAIPEREO 035 MAX SHGC COORD COORDINATE IRC INTERNATIONAL T&G TOUNGUEAND PARCEL NUMBER 212104-9003 CPT CARPET RESIDENTIALCODE GROOVE NOTE MIN SKYLIGHT FENESTRATION AREA RED'D FOR CERTAIN SINGLE STORY CT CERAMICTILE TEL TOWELBAR BUILDINGS OVER 2,500 SF WITH I5'OR GREATER CEILING HEIGHTS IN 75%OR LEGAL DESCRIPTION- PARCEL BLESS POR FOR RIDS OF FEDERAL WAY BLA#04102593-00SU REC CW COLD WATER LAM LAMINATE TOW TOPOFWALL MORE OF THE BUILDING (SOME EXCEPTIONS) 420041014900006 SO BLASTUATED IN NW 21-21-4 LY S OF S 336TH ST& W OF LAV LAVATORY TEMP TEMPERED SR5-PORTION TAXABLE d PENNY LB POUNDS THK THICK OR THICKNESS AIR LEAKAGE: DBL DOUBLR LF LINEAR FEET THRU THROUGH DEG DEGREE LT LIGHT TOPO TOPOGRAPHIC MAP LWC LIGHT WEIGHT TPD TOILET PAPER TESTING REOUIR®: A CONTINUOUS AIR BARRIER MUST BE INSTALLED IN THE BUILDING ENVELOPE DEMO DEMOLISH OR CONCRETE DISPENSER ALL BREAKS OR JOINTS IN THE AIR BARRIER WILL BE SEALED. TESTING IS DEMOLITION lYP TYPICAL REQUIRED TO ENSURE LEAKAGE RATE OF NOT MORE THAN .AD CFWFT2 ATA OF DOUGLAS FIR MATL MATERIAL PRESSURE DIFFERENTIAL OF031NCHES WATER GUAGE (20USM2AT 75PA)IN DIAM DIAG DIAMETER DIAGONAL MAX MAXIMUM UNO UNLESS NOTED ACCORDANCE WITH ASTM E779_ DIM DIMENSION MECH MECHANICAL OTHERWISE ON DOWN MFR MANUFACTURER UTIL UTILITY LIGHTING FIXTURES RECESSED LIGHTING FIXTURES INSTALLED IN THE BUILDING THERMAL ENVELOPE DG DOUBLE GLAZING MIN MINIMUM SHALL BE AIR TIGHT, IC RATED IN ACCORDANCE WITH ASTM E203 WITH NO MORE DTL DETAIL MIR MIRROR VCT VINYL COMPOSITION THAN 2.0 CU FT PER MINUTE AIR MOVEMENT FROM THE CONDITIONED SPACE TO DS DOWNSPOUT MISC MISCELLANEOUS TILE THE CEILING CAVITY. AT1.57FEE PRESSURE V5 Pe) DIFFERENCE AND SHALL BE DW DISHWASHER VERT VERTICLE LABELED. ALL RECESSED LUMINARIES SHALL BE SEALED WITH A GASKET OR NEC NATIONAL ELECTRICAL VEST VESTIBULE CAULK BETWEEN HOUSING AND INTERIOR WALL OR CEILING COVERAGE (E) EXISTING CODE VTR VENT THROUGH ROOF E EAST OREXISTING (N) NEW VTO VENTTO OUTSIDE EA EACH N NORTH OR NEW EIFS EXTERIORINSULAT10N NIC NOT IN CONTRACT W WEST FINISH SYSTEM NO. NUMBER WI WITH ELECT ELECTRICAL NOM NOMINAL WC WATER CLOSET EXT EXTERIOR NEC NOISE REDUCTION WD WOOD ELEV ELEVATION COEFFICIENT WOW WINDOW EQUIP EQUIPMENT NTS NoSCALE WE WIDE FLANGE EQ EQUAL WG WIRE GLASS EW EACH WAY OC ON CENTER WH WATER HEATER EXIST EXISTING DENG OPENING W/0 WITHOUT WP WATERPROOF FD FLOOR DRAIN PL PROPERTY LINE OR WSEC WASHINGTON STATE FDN FOUNDATION PLATE ENERGY CODE WT WEIGHT FEC FIRE EXTINGUISHER PLAM PLASTIC LAMINATE WWF WELDED WIRE FABRIC CABINET PLYWD PLYWOOD WWM WELDED WIRE MESH SHEET INDEX AO 1 TITLE SHEET A02 SITE PLAN Al 1 MAIN FLOOR PLAN Al2 FUTURE SCHOOL AZ1 SECTIONS A3.1 ELEVATIONS A32 ELEVATIONS A33 EXTFI%QR VIEWS RECEIVED APR 2 5 2019 CITY OF FEDERAL WAY COMMUNITY DEVELOPMENT VICINITY MAP N.T.S. EXISTING PLAYFIELD AREA i I DRIVE AISLE B PARKING TO BE REMOVED. j AREA TO BE LEVELED FOR USE AS PLAYFIELD PLAYFIELD EXPANSION AREA . 21 I IIEYf yaw. PAVED DRIVE ALSIE l�fun�lE swR; - • . — � NEW CONC WALK I _ - - — 1 - - FUTU- SCHGL': = i OFF IL::S NEW COURTYARD _ 00 FV TURE SCHOOL I � --••-- -'--' ciASSYtornn lYdtG i W` NEW 4YAa'9LDQ 15�707 sq II Q494mmillp m PtAYAREA a (N)GATE RELOCATED ELECTRICAL TRANSFORMER I El -/ I r f tt RECREATION SPORTS FIELD f i �tii .' �ti• y/•-° FIB' ~ EXISTING DRIVEWAY . t� •t, j� � �_;. ;_ . - TO HE RELOCATED FOR `. 1 .r . ■ .mob:•-:. E-.•r•+ �� ti. FUiUREPLAYFIELD ^ = AREA. EXISTING CHURCH )mr �I _ r I RELOCATED DRIVEWAY/FIRE LANE fo .�. �►�_ �.�, __ :_ 1. Cym � ' _. T w .. -_.. ..� � I i sing • • — • e a :— �- a =. k_k s G 4"a �.� ], e- � e n . �d.. - i EXISTING RETENTION POND 1 FUTURE SCHOOL EXPANSION �- r�1 SITE OVERVIEW MEN Era .z •, ,. SITE PLAN PHASE 1 GROUND FLOOR: 15,707 SF j 1 1r.r �"J g n� GROUND FLOOR 0BS2-)L BS1 C A2.1 A31 A2.1 FZ�.. , I. I � I I STAIR @ FUTURE EXPANSION, TYR I { I II I � III I l III I I i ELEC FS JAN I I I i MULTIPURPOSE I I TEAM 1 k I 1 I cm I A HALLWAYlip " MEN I I I 1T It 11 1 II II RETRACTABLE BLEACHERS III 264 SEATS I I II II II! Ill I I �I ICI ICI Itl I I ] I I III III Ili I I I l III II III lit I I 02 11 II I al 11 II WOMEN— t---------1� —• ------ �yI-------------•11— -------I — 1�1 11! II I I III 111 11 III i 1 Q.Q Q.Q II I I] III ill III I I I IIl III GYM !I III I I Ls ICI ,oa LI LI I I . TEAM 2 I I III Ill Ili ll I m° I I i r l I r, 1-1 l+l I I Ili III 114 III I I I I hl ICI Ir1 I•I I t I 1 lli 111 III III I I 1 1 I' I Pt I' I ,I I+t CAFE I I I'I PI f11I , I III III fll 111 I 1 A ;A� 1 l I'I I'I III I'I I1 d] --- _ .. ----- — — — -- `� Ill III 111 III I I III III !jf III I I I III III III tll I l 1 iIICI s I I, III III I IENT '' I I I ili IIT � III I'I t I t I mHUB I it ® II II III Ir III-- --------- ——- II �t —+APE— -"— I S 111 lli III III I A I{ 11 ' I , III III ,II III f I 53I,I 1,1 RETRACTABLE BLEACHERS 1 C. } I 1 I III I11 264 SEATS }t1 III 1 1 I I+,I Il,l I13 ,I jI , f l I�I III III ill I I Q I r I ICI Ir1 tri ICI I I I I lit II t l I T f e---�---- — --- — — 114 --�—I- E 1 1 II k I I I1 r•losra' a Y a Y --{-3 mw —A--'0 BS3 LEGEND $ 1 ODOOR MARKER OWINDOW MARKER Y ELEVATION MARKER --- SECTION MARKER �A\ LJ DETAILMARKER CONSTRUCTION T ASSEMBLY DIMENSION NOTE YIO1CAi�ClEN19WEN5lON f FRONL FACE 0;,STMS PHASE 1 GROUND FLOOR: 15,707 SF FUTURE EXPANSION GROUND FLOOR: 7929 SF TOTAL GROUND FLOOR: 23,636 SF JFI.JITURE EXPAN! ION 2ND FLOOR: 1 7 SF TOTAL 2NID FLOOR: 10,347 n+ � FUTURE EXPANSION, TYP. ELEC FS II AN - VEST. SCHOOLOFFICES MULTIPURPOSE @ FUTURE — EXPANSION,TYP. TEAM HALLWAY MEN I II II' BREAK. OR RETRACTABLE BLEACHERS f IIf 264 SEATS II 1L ►YpMEN II II II II _- II 11 II _ _II _ II II 11 II II II II 11 Il I! Il II GYM TEAM 2 t jl I� II Il I 4; I II II it II Il 11 II 11 11 SCHOOL OFFICE CAFE 1` II II FI rl � 11 Il II n it II It N K - - 11 I I II II fl II � • II I1 fi li Il II I! II II 11 N II II - II It I1 !! II HUB 1 II 14 li II RETRACTABLE BLEACHERS II II 11 264 SEATSY. � •.r I !I !I t Il ti CLASSROOM CLASSROOM !• f Imo; .� CLASSROOM , I I CLASSROOM WING -FUTURE EXPANSION O CLASSROOM Ix O u CLASSROOM CLASSROOM 11 CLASSROOM 3�.1'fl•I! STAIR 91 GYM + FUTURE SCHOOL - GROUND FLOOR 1/16" = V-0" L�—STAIR @ FUTURE EXPANSION, TYR CLASSROOMS& RESTROOMS @ FUTURE CLASSROOM CLASSROOM EXPANSION, TYP MEN ; fl II II II I I WOMEN o II II II II � ----- Ov II II II II II II II r I II II II II CLASSROOM 11 II II II II H II II OPEN TO GYM I II II II BELOW II II II II II II II 11 II ll II 11 II II II it II II II it II OPEN TO HUB I I I I BELOW II II 11 II II rl II II 11 n n I fl II �!I' `i j f I ril 11 it CLASSROOM CLASSROOM II -� CLASSROOM f -0 0 CLASSROOM ce O u CLASSROOM `f CLASSROOM I CLASSROOM GYM + FUTURE SCHOOL - 2ND FLOOR 1/16"= 1'-0" WING -FUTURE EXPANSION 38"0' TO PARAPET TYPICAL GYM ROOF 0UO`rMEM9RARMSTEM, COVER BOARD; R-38 RIGID INSULATION, STEEL DECKING; STEEL FRAME BY PRE-FAB MFR 0' CRICKETS & INTERNAL ROOF DRAINS J. TO FRAME —4 TYPICAL GYM EXTERIOR WALL TYPICAL ROOF RbUT MtMUM E SYSTEM, COVER BOARD; 14' 9112' TAPERED R-38 RIGID INSULATION; Bo DE STEEL DECKING (FLAT FOR FUTURE FLOOR); STEEL FRAME BY PRE-FAB MFR STEEL FRAME BY PREFAB MFR STEEL JOISTS, SIZE FOR FUTURE SECOND FLOOR A T.. CEILING, U 0 N HSS CANOPY W/ STEEL DECK, < WHERE OCCURS TYPICAL GYM EXTERIOR WALL TYPICAL GVM FLOOR TYPICAL GYM FLOOR LSED INTO B'SLAB, COURTT SED INTO 6'SLAB; CONT POLY VB, CONT POLY VB; 2' SAN D, 2' SAND; 4'GRAVEL } 4'GRAVEL EXTR SLAB PER SITE PLAN EXTR SLAB PER SITE PLAN i 13h I SLAB PERIMETER STEM W1 R-10 — PERBEIER STEM 140 R-,0 FOOTING DRAIN MTM DRAIN FOOTING PER STRUCT. F00 ING PER STRUCT. s TYP. @ GYM s TYP. WALL 2-1 1/4�� — 1_U�� 1/4" _ 1'-0" P ,5ff9 F[fIUFEiLA FLDOLi FUi1kiE hl� FLOGRF7.00A s� BUILDING SECTION .isa• FUi UAE 2R^D FLOOR Q) s 30-0'TO FRAME I I MULTI -PURPOSE ROOM GYM I I I 4.3 I I 1 I I I � ELEC. CAFE I I I HUB I 1HAN1.I. MEN fI I I I oRou�+vr�ooR6' � s� BUILDING SECTION A2.1 1/8" - 1 _0 � ems— a C.5 pO., (E} F F2 its) lHJ F I II 1 II I 1 TIT) 9 � I N1 I GROUNDFLOOR" ' BUILDING SECTION HUB GYM i NW CORNER 0 1S 31' fiI' 2� AWNING W/ SHEET METAL FASCIA HSS ROOF, TYR FUTUREFUTIIRE 7NU F100.4FL00.4 WEST 1/8" = V_01, wNaw« COL /uTC0q CHVRCM d Rf;WJF4 r a SENCH N atowz veTALSIntHc _ _� � I +F x 9d'H001 CElWITFt9ER l.V7elS--• �.. f CHR1SnAN FA" STEEL CANOPY W/STEEL DECK J. 10'-1' ALUM 51T1REFi W1 NDOW n NORTH NW CORNER I I I I _ � ate_+ tn• 0 16 3]' fi0' 2� AWNING W/ SHEET METAL FASCIA HSS ROOF, TYR FTiN To IAL f1fIHRF 7�NpRDQR — - - QRfaliwkm 1 'm leAw"pa wia:H —rcwC HFkCx b i cRF4s=Ae I f I I i HORtZ NLPA15fl)]Ns -" 6 naa'k74! CF-1Eai! F'�R CAFEELS STEEL CANOPY WI STEEL DECK A> 19 --- STMR FI T WINDOW zWES-------------------- b i i /1 NORTH SE CORNER 1/32"= V_0-- U 16 3r 6 I - L7tOW10 FLOOR y EAST i Q pi z SOUTH z ,/8" = , _0 FRONT VIEW FA -a-